Diaphorina citri psyllid: psy16023

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------

KKKKKKKKKKKKKKKKKKKKKKKNPYKPCLTDTLFCSPGVPFPPSQKLIIADVFDTRTGKPRPDVLKQHFILEGRIDETAALKIINEGATLLRSEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGPPASTKYLFLGDYVDRGYFSIECVLYLWALKLCHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHNLDDIRKTDSKSHPLSDQCVIYCGQTHSSNINLTNNRHKPSVLFTTDSKSHPLSDQCVIYCGQTHSKISAMKRTPNILVTIVYEAAPIFIVTEMLVNVLNICSDDELMSDGDDALEEVMQHAVIFSKIIISSPLSELTKHKTRGVVKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK

cHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEcccEEEEcccccHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccHHHHHHHHHcHHHHHHHHHHccccHHHEEEcccEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHcccccccccccHHHHHHHHHcccccEEEEEccccccccccccccccEEEEEEEEccccEEEEEccccccccccccccEEEEEccccccc

****************************CLTDTLFCSPGVPFPPSQKLIIADVFDTRTGKPRPDVLKQHFILEGRIDETAALKIINEGATLLRSEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGPPASTKYLFLGDYVDRGYFSIECVLYLWALKLCHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHNLDDIRKTDSKSHPLSDQCVIYCGQTHSSNINLTNNRHKPSVLFTTDSKSHPLSDQCVIYCGQTHSKISAMKRTPNILVTIVYEAAPIFIVTEMLVNVLNICSDDELMSDGDDALEEVMQHAVIFSKIIISSPLSELTKHKTRGVVKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGE*

xxxxxxxxxxxxxxxxxxxxxxxxHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxPYKPCLTDTLFCSPGVPFPPSQKLIIADVFDTRTGKPRPDVLKQHFILEGRIDETAALKIINEGATLLRSEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGPPASTKYLFLGDYVDRGYFSIECVLYLWALKLCHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHNLDDIRKTDSKSHPLSDQCVIYCGQTHSSNINLTNNRHKPSVLFTTDSKSHPLSDQCVIYCGQTHSKISAMKRTPNILVTIVYEAAPIFIVTEMLVNVLNICSDDELMSDGDDALEEVMQHAVIFSKIIISSPLSELTKHKTRGVVKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. Dephosphorylates DNM1L, HSPB1 and SSH1.	confident	Q08209
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. Dephosphorylates DNM1L, HSPB1 and SSH1.	confident	P48452
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. Dephosphorylates DNM1L and HSPB1 (By similarity). Dephosphorylates SSH1.	confident	P63328

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051716 [BP]	cellular response to stimulus	confident	GO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0043025 [CC]	neuronal cell body	confident	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0004722 [MF]	protein serine/threonine phosphatase activity	confident	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0030431 [BP]	sleep	confident	GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]	nucleus	confident	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030424 [CC]	axon	confident	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005955 [CC]	calcineurin complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043204 [CC]	perikaryon	probable	GO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0008144 [MF]	drug binding	probable	GO:0003674, GO:0005488
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0033192 [MF]	calmodulin-dependent protein phosphatase activity	probable	GO:0016787, GO:0016791, GO:0004723, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788
GO:0035690 [BP]	cellular response to drug	probable	GO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005929 [CC]	cilium	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0005516 [MF]	calmodulin binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0006606 [BP]	protein import into nucleus	probable	GO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0016482, GO:0017038, GO:0034613, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0033173 [BP]	calcineurin-NFAT signaling cascade	probable	GO:0044700, GO:0051716, GO:0019722, GO:0050896, GO:0009987, GO:0008150, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699, GO:0048016
GO:0030018 [CC]	Z disc	probable	GO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0014883 [BP]	transition between fast and slow fiber	probable	GO:0044057, GO:0014733, GO:0065007, GO:0090257, GO:0051239, GO:0008150, GO:0043502, GO:0050789
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0017156 [BP]	calcium ion-dependent exocytosis	probable	GO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0051592 [BP]	response to calcium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0072375 [BP]	medium-term memory	probable	GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0030346 [MF]	protein phosphatase 2B binding	probable	GO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0019855 [MF]	calcium channel inhibitor activity	probable	GO:0016247, GO:0005246, GO:0003674, GO:0008200, GO:0016248
GO:0000164 [CC]	protein phosphatase type 1 complex	probable	GO:0005737, GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035176 [BP]	social behavior	probable	GO:0050896, GO:0007610, GO:0008150, GO:0051703, GO:0051705, GO:0051704
GO:0032844 [BP]	regulation of homeostatic process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0036170 [BP]	filamentous growth of a population of unicellular organisms in response to starvation	probable	GO:0009991, GO:0040007, GO:0009605, GO:0030447, GO:0044182, GO:0031667, GO:0006950, GO:0008150, GO:0042594, GO:0050896, GO:0044699
GO:0043029 [BP]	T cell homeostasis	probable	GO:0042592, GO:0048872, GO:0002260, GO:0002376, GO:0001776, GO:0008150, GO:0065007, GO:0065008
GO:0051533 [BP]	positive regulation of NFAT protein import into nucleus	probable	GO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:0042993, GO:0042990, GO:1900180, GO:0051532, GO:0046824, GO:0046822
GO:0001975 [BP]	response to amphetamine	probable	GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0014075, GO:1901698
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0006468 [BP]	protein phosphorylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0040018 [BP]	positive regulation of multicellular organism growth	probable	GO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0048675 [BP]	axon extension	probable	GO:0032502, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0000082 [BP]	G1/S transition of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0019915 [BP]	lipid storage	probable	GO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0071333 [BP]	cellular response to glucose stimulus	probable	GO:0042592, GO:0042593, GO:0070887, GO:0048878, GO:0044699, GO:0051716, GO:0033500, GO:0071310, GO:0065007, GO:0071331, GO:0065008, GO:0019725, GO:1901700, GO:0009987, GO:0044763, GO:0001678, GO:0042221, GO:0055082, GO:0010033, GO:0009746, GO:1901701, GO:0009743, GO:0034284, GO:0071322, GO:0050896, GO:0071326, GO:0009749, GO:0008150
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000159 [CC]	protein phosphatase type 2A complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046716 [BP]	muscle cell homeostasis	probable	GO:0019725, GO:0060249, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0036180 [BP]	filamentous growth of a population of unicellular organisms in response to biotic stimulus	probable	GO:0009607, GO:0040007, GO:0050896, GO:0044182, GO:0008150, GO:0030447, GO:0044699
GO:0030289 [CC]	protein phosphatase 4 complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0017018 [MF]	myosin phosphatase activity	probable	GO:0016787, GO:0016791, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788
GO:0001915 [BP]	negative regulation of T cell mediated cytotoxicity	probable	GO:0048585, GO:0048583, GO:0002819, GO:0002707, GO:0002706, GO:0002704, GO:0002703, GO:0031341, GO:0031342, GO:0050789, GO:0002709, GO:0002697, GO:0002682, GO:0002683, GO:0048519, GO:0002822, GO:0002823, GO:0002820, GO:0002710, GO:0008150, GO:0050777, GO:0050776, GO:0065007, GO:0001911, GO:0001910, GO:0001914, GO:0002698
GO:0060079 [BP]	regulation of excitatory postsynaptic membrane potential	probable	GO:0042391, GO:0019226, GO:0035637, GO:0050801, GO:0042592, GO:0051899, GO:0023052, GO:0007154, GO:0044699, GO:0065007, GO:0065008, GO:0019725, GO:0032501, GO:0050877, GO:0009987, GO:0006873, GO:0044763, GO:0007268, GO:0007267, GO:0060078, GO:0055082, GO:0003008, GO:0044700, GO:0044707, GO:0048878, GO:0008150
GO:0071472 [BP]	cellular response to salt stress	probable	GO:0009628, GO:0051716, GO:0009987, GO:0050896, GO:0071470, GO:0044763, GO:0008150, GO:0006950, GO:0006970, GO:0033554, GO:0009651, GO:0071214, GO:0044699
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0009405 [BP]	pathogenesis	probable	GO:0008150, GO:0051704
GO:0031929 [BP]	TOR signaling cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0035220 [BP]	wing disc development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005819 [CC]	spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0006470 [BP]	protein dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0072357 [CC]	PTW/PP1 phosphatase complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005575
GO:0040024 [BP]	dauer larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0002119, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009966 [BP]	regulation of signal transduction	probable	GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0007612 [BP]	learning	probable	GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0032153 [CC]	cell division site	probable	GO:0005575, GO:0044464, GO:0005623
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0048167 [BP]	regulation of synaptic plasticity	probable	GO:0065008, GO:0044057, GO:0031644, GO:0050804, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0071216 [BP]	cellular response to biotic stimulus	probable	GO:0051716, GO:0009607, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0034097 [BP]	response to cytokine stimulus	probable	GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0006816 [BP]	calcium ion transport	probable	GO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0005935 [CC]	cellular bud neck	probable	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0046676 [BP]	negative regulation of insulin secretion	probable	GO:0090087, GO:0051046, GO:0051048, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048519, GO:0051051, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046888, GO:0032879, GO:0090278, GO:0002791, GO:0002792, GO:0048523
GO:0070688 [CC]	MLL5-L complex	probable	GO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0007143 [BP]	female meiosis	probable	GO:0007126, GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0030217 [BP]	T cell differentiation	probable	GO:0030154, GO:0042110, GO:0045321, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0048731, GO:0002521, GO:0002520, GO:0044707, GO:0048856, GO:0030097, GO:0002376, GO:0030098, GO:0008150
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0000775 [CC]	chromosome, centromeric region	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0000794 [CC]	condensed nuclear chromosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0007507 [BP]	heart development	probable	GO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031505 [BP]	fungal-type cell wall organization	probable	GO:0008150, GO:0009987, GO:0016043, GO:0071554, GO:0071555, GO:0044763, GO:0044699, GO:0045229, GO:0071840, GO:0071852
GO:0009790 [BP]	embryo development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0048741 [BP]	skeletal muscle fiber development	probable	GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0048869, GO:0007519, GO:0008150, GO:0048513, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0048731, GO:0042692
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.16	Phosphoprotein phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AUI, chain A
Confidence level:very confident
Coverage over the Query: 33-290,311-416
View the alignment between query and template
View the model in PyMOL

Template: 1M63, chain A
Confidence level:very confident
Coverage over the Query: 28-252,267-293,310-416
View the alignment between query and template
View the model in PyMOL