Query         psy1603
Match_columns 175
No_of_seqs    83 out of 85
Neff          4.1 
Searched_HMMs 46136
Date          Fri Aug 16 19:04:32 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1603.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1603hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11018 Cuticle_3:  Pupal cuti 100.0 1.8E-34 3.9E-39  236.9   7.0  137   32-175     1-174 (174)
  2 PF04527 Retinin_C:  Drosophila  96.0  0.0047   1E-07   44.4   2.4   47   50-100     7-57  (66)
  3 PTZ00459 mucin-associated surf  34.1      28 0.00061   30.9   2.0   19    1-19      1-21  (291)
  4 PRK12750 cpxP periplasmic repr  28.8      43 0.00094   27.5   2.1   19    1-19      1-19  (170)
  5 PF13956 Ibs_toxin:  Toxin Ibs,  24.6      33 0.00072   19.2   0.5   12    3-14      1-13  (19)
  6 PF08139 LPAM_1:  Prokaryotic m  23.5      79  0.0017   18.8   2.0   13    2-14      5-17  (25)
  7 PF07172 GRP:  Glycine rich pro  21.5      77  0.0017   23.9   2.1   11    1-12      1-11  (95)
  8 PF06286 Coleoptericin:  Coleop  20.2      27 0.00058   28.5  -0.6   16    3-18      1-16  (143)
  9 PRK15208 long polar fimbrial c  16.2      88  0.0019   26.5   1.6   21    3-23      5-26  (228)
 10 KOG4063|consensus               15.1 1.2E+02  0.0027   25.2   2.1   17    3-19      5-21  (158)

No 1  
>PF11018 Cuticle_3:  Pupal cuticle protein C1;  InterPro: IPR022727  Insect cuticles are composite structures whose mechanical properties are optimised for biological function. The major components are the chitin filament system and the cuticular proteins, and the cuticle's properties are determined largely by the interactions between these two sets of molecules. The proteins can be ordered by species. 
Probab=100.00  E-value=1.8e-34  Score=236.92  Aligned_cols=137  Identities=51%  Similarity=0.746  Sum_probs=95.2

Q ss_pred             ccCcccceecceeeecCCcceeeeecccccCCCcceeeecccccccccccccccc--------cccceecCCccc-ee-c
Q psy1603          32 AHSAVGSQSQSVVRSLDGNSVHSVYSKAVDTPFSSVRKYDSRVSNDAIAYAHAPV--------YHAPVYSAPVVK-SV-A  101 (175)
Q Consensus        32 a~pAv~at~~sivrs~~~~a~VstysKaI~Tp~Ssv~k~d~rVsn~a~~~a~a~v--------~k~~~yaaPv~~-tY-~  101 (175)
                      +.++|++|||||+|+++  ++||+|+|+|||||||+||+|+||+||++++++++.        .+...+++|+.. .| +
T Consensus         1 ~~~av~~t~~~~~r~~~--~~vS~yskav~tp~Ssv~k~d~risN~~~~~a~A~~~~~a~~~~a~~~a~aAPvv~~s~aA   78 (174)
T PF11018_consen    1 SAPAVGSTQENTVRSFG--GTVSHYSKAVDTPYSSVRKSDTRISNDAYTPAYAAPAYAAPAPYAKPYAAAAPVVAKSYAA   78 (174)
T ss_pred             CCccccccccceeeccC--cceeeeccCCCCCcceeEecccceecCccccccccccccccccccccccccCcceeeeccc
Confidence            46899999999999999  599999999999999999999999999999877531        122346677664 33 2


Q ss_pred             cc--cccc-ccccccc-------CC----CCccCCc---cccccCCC-CC-------CCc--ccccccccccCCcccccc
Q psy1603         102 PV--TYAA-APVLKYA-------AP----YPYHAPV---VKSIAHPV-AY-------SPV--AYHAPVSAGVAPYAVKAP  154 (175)
Q Consensus       102 ~~--~Ya~-ap~~~YA-------AP----~~y~ap~---~~~~ah~~-~~-------ap~--a~aAP~~a~~~~~~~~v~  154 (175)
                      |+  ++.. +|...|.       +|    ..|.+|.   ...++.++ ++       +|.  +++||++     ..+.|+
T Consensus        79 Pv~~~~~~AaPa~~~a~~~~~aaAP~~~~~a~aAPa~~~~~~yAa~apv~~~~~~~~a~~~Ya~aAPvv-----a~~~V~  153 (174)
T PF11018_consen   79 PVVAKYAYAAPAVVYAKAAYAAAAPAYAKTAYAAPAVYAQTTYAAPAPVYAQTYAAAAPAVYAHAAPVV-----AAATVS  153 (174)
T ss_pred             cccccccccCcccccccccccccCcceeeeeecccccccceeeccCCcccccccccccccccccccccc-----ccccee
Confidence            22  1111 3332221       34    2245554   12223222 21       122  4567764     278999


Q ss_pred             ccCCceeceeeccCCCccCCC
Q psy1603         155 YSPAAVVSHVDFDGYGVHYAF  175 (175)
Q Consensus       155 YspA~~vsh~s~~g~g~~yg~  175 (175)
                      |||+++||||||||||.||||
T Consensus       154 YSpA~~VsH~s~~g~g~~yg~  174 (174)
T PF11018_consen  154 YSPAPAVSHMSFDGFGAHYGW  174 (174)
T ss_pred             eccCCeeEEEeecCCcccccC
Confidence            999999999999999999999


No 2  
>PF04527 Retinin_C:  Drosophila Retinin like protein;  InterPro: IPR007614 This entry consists of a number of Drosophila proteins which share a conserved C-terminal region related to that of the fly Retinin protein.
Probab=96.05  E-value=0.0047  Score=44.43  Aligned_cols=47  Identities=32%  Similarity=0.352  Sum_probs=38.5

Q ss_pred             cceeeeecccccCCCc---ceeeeccc-ccccccccccccccccceecCCcccee
Q psy1603          50 NSVHSVYSKAVDTPFS---SVRKYDSR-VSNDAIAYAHAPVYHAPVYSAPVVKSV  100 (175)
Q Consensus        50 ~a~VstysKaI~Tp~S---sv~k~d~r-Vsn~a~~~a~a~v~k~~~yaaPv~~tY  100 (175)
                      ++.|+...|.++|+.|   +.+.+|+| |..|.+    +|++|++...+|+++++
T Consensus         7 va~VG~vv~~vPtAVSHQS~T~VH~~a~vv~pvv----aPvVkttvv~~Pv~~~~   57 (66)
T PF04527_consen    7 VAKVGAVVKSVPTAVSHQSSTQVHSKAPVVTPVV----APVVKTTVVAAPVVKTT   57 (66)
T ss_pred             ccccceEEEecCccccccceeEEEccCceeeeee----cceEEEEEecCCceeee
Confidence            5678889999999996   77788884 888888    67788887788988764


No 3  
>PTZ00459 mucin-associated surface protein (MASP); Provisional
Probab=34.06  E-value=28  Score=30.87  Aligned_cols=19  Identities=37%  Similarity=0.623  Sum_probs=11.9

Q ss_pred             Chhh--HHHHHHHHHHHHhcC
Q psy1603           1 MQMF--QLALLTCLLVAVQAG   19 (175)
Q Consensus         1 ~~mf--K~vv~~~~laaA~AG   19 (175)
                      |+|+  -=|||+|+|.+-|-|
T Consensus         1 MaMmMTGRVLLVCALCVLWCg   21 (291)
T PTZ00459          1 MAMMMTGRVLLVCALCVLWCG   21 (291)
T ss_pred             CccchhchHHHHHHHHHHhcC
Confidence            6665  225666887776654


No 4  
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=28.79  E-value=43  Score=27.50  Aligned_cols=19  Identities=16%  Similarity=0.427  Sum_probs=12.6

Q ss_pred             ChhhHHHHHHHHHHHHhcC
Q psy1603           1 MQMFQLALLTCLLVAVQAG   19 (175)
Q Consensus         1 ~~mfK~vv~~~~laaA~AG   19 (175)
                      |+|+|.++++|++..---|
T Consensus         1 ~~~~kkl~~~~v~~~l~lg   19 (170)
T PRK12750          1 MKLAKKLVLAAVVLPLTLG   19 (170)
T ss_pred             CchHHHHHHHHHHHHHHHH
Confidence            8999887666665553334


No 5  
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=24.59  E-value=33  Score=19.24  Aligned_cols=12  Identities=33%  Similarity=0.747  Sum_probs=6.6

Q ss_pred             hhHHHHH-HHHHH
Q psy1603           3 MFQLALL-TCLLV   14 (175)
Q Consensus         3 mfK~vv~-~~~la   14 (175)
                      |+|++++ ..+|.
T Consensus         1 MMk~vIIlvvLLl   13 (19)
T PF13956_consen    1 MMKLVIILVVLLL   13 (19)
T ss_pred             CceehHHHHHHHh
Confidence            6688554 34443


No 6  
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=23.54  E-value=79  Score=18.77  Aligned_cols=13  Identities=23%  Similarity=0.358  Sum_probs=7.4

Q ss_pred             hhhHHHHHHHHHH
Q psy1603           2 QMFQLALLTCLLV   14 (175)
Q Consensus         2 ~mfK~vv~~~~la   14 (175)
                      .|+|.+++..+.+
T Consensus         5 ~mmKkil~~l~a~   17 (25)
T PF08139_consen    5 SMMKKILFPLLAL   17 (25)
T ss_pred             HHHHHHHHHHHHH
Confidence            6787755544433


No 7  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=21.46  E-value=77  Score=23.86  Aligned_cols=11  Identities=36%  Similarity=0.244  Sum_probs=4.6

Q ss_pred             ChhhHHHHHHHH
Q psy1603           1 MQMFQLALLTCL   12 (175)
Q Consensus         1 ~~mfK~vv~~~~   12 (175)
                      |+ -|.+|||+|
T Consensus         1 Ma-SK~~llL~l   11 (95)
T PF07172_consen    1 MA-SKAFLLLGL   11 (95)
T ss_pred             Cc-hhHHHHHHH
Confidence            44 354443333


No 8  
>PF06286 Coleoptericin:  Coleoptericin;  InterPro: IPR009382 This family consists of several insect coleoptericin, acaloleptin, holotricin and rhinocerosin proteins which are all known to be antibacterial proteins []. These all appear to be short, glycine-rich molecules, inducible by infection.; GO: 0042742 defense response to bacterium, 0005576 extracellular region
Probab=20.18  E-value=27  Score=28.47  Aligned_cols=16  Identities=25%  Similarity=0.366  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHHHHhc
Q psy1603           3 MFQLALLTCLLVAVQA   18 (175)
Q Consensus         3 mfK~vv~~~~laaA~A   18 (175)
                      |+||+|.+||++...+
T Consensus         1 mmkl~i~~~lia~saa   16 (143)
T PF06286_consen    1 MMKLYIIFGLIALSAA   16 (143)
T ss_pred             CceEeeehhHHHHHHh
Confidence            7899888888887554


No 9  
>PRK15208 long polar fimbrial chaperone LpfB; Provisional
Probab=16.23  E-value=88  Score=26.52  Aligned_cols=21  Identities=29%  Similarity=0.165  Sum_probs=14.2

Q ss_pred             hhH-HHHHHHHHHHHhcCCCCc
Q psy1603           3 MFQ-LALLTCLLVAVQAGDYPS   23 (175)
Q Consensus         3 mfK-~vv~~~~laaA~AG~la~   23 (175)
                      ||+ |++|+|....++||+...
T Consensus         5 ~~~~~~~~~~~~~~a~agv~l~   26 (228)
T PRK15208          5 SFTALALALIAQNSFAGGVALS   26 (228)
T ss_pred             HHHHHHHHHHhhHhhhccEEeC
Confidence            786 566666666688886543


No 10 
>KOG4063|consensus
Probab=15.08  E-value=1.2e+02  Score=25.23  Aligned_cols=17  Identities=24%  Similarity=0.335  Sum_probs=11.1

Q ss_pred             hhHHHHHHHHHHHHhcC
Q psy1603           3 MFQLALLTCLLVAVQAG   19 (175)
Q Consensus         3 mfK~vv~~~~laaA~AG   19 (175)
                      .||+++|++||.-++|.
T Consensus         5 ~~~~v~l~alls~a~aq   21 (158)
T KOG4063|consen    5 FLKTVILLALLSLAAAQ   21 (158)
T ss_pred             HHHHHHHHHHHHHhhhc
Confidence            34666776666667765


Done!