Query         psy1606
Match_columns 285
No_of_seqs    223 out of 1278
Neff          8.5 
Searched_HMMs 46136
Date          Fri Aug 16 19:48:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1606.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1606hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3607|consensus              100.0 1.1E-55 2.4E-60  427.7  24.3  281    1-282    93-391 (716)
  2 PF01421 Reprolysin:  Reprolysi 100.0 1.5E-53 3.4E-58  361.3  17.5  197   85-281     1-199 (199)
  3 cd04269 ZnMc_adamalysin_II_lik 100.0 2.2E-51 4.8E-56  346.7  21.3  194   85-279     1-194 (194)
  4 cd04273 ZnMc_ADAMTS_like Zinc- 100.0 1.4E-47   3E-52  326.5  15.4  189   85-278     1-207 (207)
  5 cd04272 ZnMc_salivary_gland_MP 100.0 5.7E-45 1.2E-49  313.2  18.2  189   86-278     2-220 (220)
  6 cd04267 ZnMc_ADAM_like Zinc-de 100.0 7.3E-43 1.6E-47  294.3  18.9  182   85-270     1-192 (192)
  7 cd04271 ZnMc_ADAM_fungal Zinc- 100.0 9.1E-43   2E-47  299.6  17.1  186   86-278     2-228 (228)
  8 cd04270 ZnMc_TACE_like Zinc-de 100.0 2.2E-41 4.8E-46  294.4  14.5  193   86-280     2-240 (244)
  9 KOG3538|consensus              100.0   8E-30 1.7E-34  256.3  17.5  273    2-281    82-384 (845)
 10 KOG3658|consensus              100.0 9.4E-30   2E-34  237.4  16.3  273    5-279   107-463 (764)
 11 PF13688 Reprolysin_5:  Metallo 100.0 6.4E-29 1.4E-33  209.9  13.5  171   84-258     2-196 (196)
 12 PF13583 Reprolysin_4:  Metallo  99.9 1.4E-23   3E-28  178.3  16.4  186   84-276     2-205 (206)
 13 cd00203 ZnMc Zinc-dependent me  99.9 1.1E-23 2.4E-28  173.3  11.8  148   85-268     1-166 (167)
 14 PF13574 Reprolysin_2:  Metallo  99.9 7.2E-25 1.6E-29  181.3   4.5  154  107-270     2-172 (173)
 15 PF13582 Reprolysin_3:  Metallo  99.8 1.3E-19 2.8E-24  141.9   5.8  122  110-232     2-124 (124)
 16 PRK13267 archaemetzincin-like   98.9 5.6E-09 1.2E-13   86.4   9.7   73  170-250    69-154 (179)
 17 PF07998 Peptidase_M54:  Peptid  98.4 5.7E-07 1.2E-11   75.0   5.9   67  175-250    98-173 (194)
 18 PF01562 Pep_M12B_propep:  Repr  98.0 2.6E-06 5.7E-11   67.1   2.3   36    2-38     77-120 (131)
 19 COG1913 Predicted Zn-dependent  97.9 4.1E-06   9E-11   67.7   1.7   50  215-270   124-177 (181)
 20 cd04275 ZnMc_pappalysin_like Z  97.7 9.1E-05   2E-09   63.7   6.8  117  110-234    25-156 (225)
 21 PF00413 Peptidase_M10:  Matrix  97.7 3.7E-05 8.1E-10   61.9   4.2   48  215-268   105-152 (154)
 22 cd04268 ZnMc_MMP_like Zinc-dep  97.5 0.00068 1.5E-08   55.2   9.3   35  216-250    95-139 (165)
 23 cd04279 ZnMc_MMP_like_1 Zinc-d  97.3 0.00026 5.6E-09   57.4   3.6   49  215-268   104-154 (156)
 24 PF12388 Peptidase_M57:  Dual-a  97.2 0.00066 1.4E-08   57.3   5.8   23  211-233   129-151 (211)
 25 cd04278 ZnMc_MMP Zinc-dependen  97.2 0.00032 6.9E-09   56.9   3.6   46  216-267   108-154 (157)
 26 PF05548 Peptidase_M11:  Gameto  96.9  0.0013 2.9E-08   59.3   4.8   70  172-248   114-184 (314)
 27 PF02031 Peptidase_M7:  Strepto  96.7  0.0011 2.3E-08   51.1   2.1   31  216-250    78-108 (132)
 28 smart00235 ZnMc Zinc-dependent  96.6  0.0011 2.3E-08   52.7   1.6   18  217-234    88-105 (140)
 29 PF05572 Peptidase_M43:  Pregna  96.3  0.0016 3.5E-08   52.7   1.0   23  215-237    69-92  (154)
 30 cd04277 ZnMc_serralysin_like Z  96.1  0.0033 7.3E-08   52.4   2.0   35  216-250   114-158 (186)
 31 cd04276 ZnMc_MMP_like_2 Zinc-d  95.8  0.0085 1.9E-07   50.5   3.2   20  215-234   116-135 (197)
 32 cd04327 ZnMc_MMP_like_3 Zinc-d  94.8   0.014   3E-07   49.3   1.4   18  217-234    94-111 (198)
 33 PF10462 Peptidase_M66:  Peptid  94.4   0.022 4.8E-07   51.0   1.9   16  216-231   194-209 (305)
 34 cd04283 ZnMc_hatching_enzyme Z  94.1   0.024 5.2E-07   47.2   1.4   17  217-233    79-95  (182)
 35 cd04281 ZnMc_BMP1_TLD Zinc-dep  93.7    0.03 6.4E-07   47.3   1.3   17  217-233    89-105 (200)
 36 cd04280 ZnMc_astacin_like Zinc  93.7   0.029 6.4E-07   46.6   1.2   17  217-233    76-92  (180)
 37 PF01400 Astacin:  Astacin (Pep  93.3   0.033 7.2E-07   46.7   1.0   18  216-233    80-97  (191)
 38 KOG1565|consensus               93.3    0.06 1.3E-06   51.3   2.7   30  215-250   211-240 (469)
 39 cd04282 ZnMc_meprin Zinc-depen  92.6   0.056 1.2E-06   46.6   1.3   17  217-233   122-138 (230)
 40 TIGR03296 M6dom_TIGR03296 M6 f  91.9   0.044 9.5E-07   49.0  -0.2   33  216-248   166-203 (286)
 41 smart00608 ACR ADAM Cysteine-R  89.6    0.43 9.4E-06   37.8   3.6   60    1-66     72-131 (137)
 42 COG3824 Predicted Zn-dependent  88.9    0.19 4.1E-06   38.4   1.0   20  214-233   108-127 (136)
 43 KOG3714|consensus               88.8    0.16 3.4E-06   47.8   0.7   17  217-233   161-177 (411)
 44 PF01431 Peptidase_M13:  Peptid  88.5    0.24 5.2E-06   41.8   1.5   16  212-227    33-48  (206)
 45 PF12044 Metallopep:  Putative   88.5    0.27 5.9E-06   46.2   1.9   18  218-235   319-336 (423)
 46 PF09471 Peptidase_M64:  IgA Pe  87.3     0.4 8.7E-06   42.3   2.2   20  215-234   216-235 (264)
 47 KOG3624|consensus               84.2    0.97 2.1E-05   45.5   3.5   17  211-227   514-530 (687)
 48 PF06262 DUF1025:  Possibl zinc  84.2    0.76 1.7E-05   34.1   2.0   19  214-232    72-90  (97)
 49 PF12725 DUF3810:  Protein of u  83.6    0.56 1.2E-05   42.6   1.4   19  215-233   196-214 (318)
 50 PF11350 DUF3152:  Protein of u  83.6    0.91   2E-05   38.1   2.5   42  215-265   139-183 (203)
 51 PF06114 DUF955:  Domain of unk  83.5     1.1 2.3E-05   33.6   2.7   18  210-227    37-54  (122)
 52 KOG4525|consensus               82.9    0.75 1.6E-05   42.9   1.9   19  217-235   303-321 (614)
 53 COG2856 Predicted Zn peptidase  81.5    0.69 1.5E-05   39.4   1.1   13  215-227    72-84  (213)
 54 PF13485 Peptidase_MA_2:  Pepti  80.3     1.2 2.6E-05   33.6   2.0   15  213-227    23-37  (128)
 55 COG4783 Putative Zn-dependent   79.0     1.1 2.4E-05   42.4   1.6   17  212-228   127-143 (484)
 56 PF01863 DUF45:  Protein of unk  78.5     2.2 4.7E-05   35.8   3.2   22  213-234   162-183 (205)
 57 COG3590 PepO Predicted metallo  78.5    0.68 1.5E-05   44.7   0.1   25  211-235   483-510 (654)
 58 PF05547 Peptidase_M6:  Immune   75.4    0.52 1.1E-05   46.7  -1.7   34  216-249   222-260 (645)
 59 PF01435 Peptidase_M48:  Peptid  72.9     2.1 4.6E-05   36.1   1.7   16  213-228    87-102 (226)
 60 COG5549 Predicted Zn-dependent  67.3     3.5 7.6E-05   34.8   1.7   21  213-233   185-206 (236)
 61 TIGR02290 M3_fam_3 oligoendope  66.3     5.2 0.00011   39.5   3.0   12  216-227   376-387 (587)
 62 PRK03001 M48 family peptidase;  65.9     3.5 7.6E-05   36.7   1.6   15  213-227   122-136 (283)
 63 TIGR02289 M3_not_pepF oligoend  65.8     5.5 0.00012   39.0   3.0   12  216-227   338-349 (549)
 64 PRK03982 heat shock protein Ht  65.1     3.7   8E-05   36.7   1.6   15  213-227   123-137 (288)
 65 PRK01345 heat shock protein Ht  63.7     4.1   9E-05   37.0   1.7   15  213-227   122-136 (317)
 66 PRK03072 heat shock protein Ht  63.2     4.2 9.2E-05   36.4   1.6   16  213-228   125-140 (288)
 67 PF04228 Zn_peptidase:  Putativ  61.7     5.1 0.00011   35.9   1.8   13  214-226   169-181 (292)
 68 COG0501 HtpX Zn-dependent prot  61.5     4.8  0.0001   35.8   1.7   14  214-227   156-169 (302)
 69 PF01433 Peptidase_M1:  Peptida  60.4      17 0.00036   33.5   5.1   14  214-227   294-307 (390)
 70 PRK05457 heat shock protein Ht  59.9     5.3 0.00011   35.7   1.6   15  213-227   132-146 (284)
 71 PRK04897 heat shock protein Ht  59.7     5.3 0.00011   35.9   1.6   15  213-227   135-149 (298)
 72 COG1164 Oligoendopeptidase F [  59.2     9.1  0.0002   38.0   3.2   12  216-227   381-392 (598)
 73 TIGR00181 pepF oligoendopeptid  58.7     4.5 9.9E-05   39.9   1.1   13  215-227   378-390 (591)
 74 PF01447 Peptidase_M4:  Thermol  57.9     5.3 0.00011   32.1   1.1   12  216-227   136-147 (150)
 75 KOG2719|consensus               57.5     5.6 0.00012   37.4   1.4   39  186-226   247-291 (428)
 76 PRK01265 heat shock protein Ht  56.8     6.4 0.00014   35.9   1.6   14  214-227   139-152 (324)
 77 PF04298 Zn_peptidase_2:  Putat  56.8     7.9 0.00017   33.2   2.1   12  216-227    90-101 (222)
 78 PRK02870 heat shock protein Ht  56.6     6.4 0.00014   36.0   1.6   14  213-226   171-184 (336)
 79 PRK02391 heat shock protein Ht  56.6     6.5 0.00014   35.3   1.6   15  213-227   131-145 (296)
 80 PF13699 DUF4157:  Domain of un  55.2     5.8 0.00013   28.1   0.9   11  217-227    63-73  (79)
 81 COG1451 Predicted metal-depend  54.5     9.1  0.0002   32.9   2.1   20  214-233   174-193 (223)
 82 cd02639 R3H_RRM R3H domain of   54.0       8 0.00017   25.9   1.3   18  217-234    31-48  (60)
 83 PF08325 WLM:  WLM domain;  Int  53.0      11 0.00024   31.4   2.4   23  212-234    79-101 (186)
 84 PF01457 Peptidase_M8:  Leishma  52.5     7.8 0.00017   37.7   1.5   59  170-231   159-226 (521)
 85 cd06455 M3A_TOP Peptidase M3 T  52.3     7.2 0.00016   37.4   1.3   13  215-227   263-275 (472)
 86 PF01432 Peptidase_M3:  Peptida  51.7     7.5 0.00016   37.0   1.3   12  216-227   243-254 (458)
 87 TIGR02414 pepN_proteo aminopep  51.7      27 0.00058   36.3   5.3   14  214-227   282-295 (863)
 88 PHA02456 zinc metallopeptidase  51.6      13 0.00027   28.2   2.2   35  193-228    58-92  (141)
 89 cd06459 M3B_Oligoendopeptidase  51.3     7.3 0.00016   36.5   1.1   12  216-227   223-234 (427)
 90 PF13398 Peptidase_M50B:  Pepti  50.6      10 0.00022   31.9   1.8   16  215-230    22-37  (200)
 91 PRK14015 pepN aminopeptidase N  50.0      34 0.00075   35.6   5.8   14  214-227   295-308 (875)
 92 PF08219 TOM13:  Outer membrane  49.9      13 0.00029   26.0   1.9   18  213-230    50-67  (77)
 93 PTZ00257 Glycoprotein GP63 (le  49.5      24 0.00052   35.0   4.3   58  170-230   205-271 (622)
 94 PF12315 DUF3633:  Protein of u  47.8      17 0.00037   30.8   2.6   26  203-228    81-106 (212)
 95 COG4784 Putative Zn-dependent   46.9      12 0.00026   34.2   1.7   18  213-231   122-139 (479)
 96 COG2321 Predicted metalloprote  46.8      12 0.00025   33.1   1.5   14  213-226   165-178 (295)
 97 cd06461 M2_ACE Peptidase famil  46.2      21 0.00045   34.4   3.3   12  217-228   249-260 (477)
 98 PF13402 M60-like:  Peptidase M  44.5     9.7 0.00021   34.0   0.8   14  217-230   221-234 (307)
 99 cd06457 M3A_MIP Peptidase M3 m  44.1      12 0.00025   35.9   1.3   13  215-227   248-260 (458)
100 COG2738 Predicted Zn-dependent  42.1      17 0.00037   30.5   1.8   18  216-233    93-110 (226)
101 PF02163 Peptidase_M50:  Peptid  39.5      19 0.00042   29.6   1.8   19  215-233     7-25  (192)
102 cd02641 R3H_Smubp-2_like R3H d  39.3      18 0.00038   24.2   1.2   20  216-235    30-49  (60)
103 PTZ00337 surface protease GP63  38.9      16 0.00034   36.0   1.3   17  215-231   229-245 (567)
104 cd06258 Peptidase_M3_like The   37.8      16 0.00035   33.5   1.2   12  216-227   155-166 (365)
105 KOG2661|consensus               37.4      19 0.00042   32.7   1.5   15  213-227   273-287 (424)
106 cd06460 M32_Taq Peptidase fami  37.0      22 0.00049   33.3   2.0   20  211-230   155-177 (396)
107 cd06163 S2P-M50_PDZ_RseP-like   36.0      24 0.00052   29.3   1.8   14  215-228     9-22  (182)
108 KOG1047|consensus               34.5      24 0.00052   34.3   1.7   12  216-227   289-300 (613)
109 cd05709 S2P-M50 Site-2 proteas  34.4      26 0.00056   28.6   1.8   17  215-231     8-24  (180)
110 PF14891 Peptidase_M91:  Effect  34.2      18  0.0004   29.6   0.8   21  214-234   102-122 (174)
111 PF00480 ROK:  ROK family;  Int  33.1      19 0.00041   29.1   0.7   28  217-245   144-171 (179)
112 cd06164 S2P-M50_SpoIVFB_CBS Sp  33.1      28  0.0006   30.0   1.8   19  214-232    52-70  (227)
113 cd06456 M3A_DCP_Oligopeptidase  32.8      23 0.00049   33.6   1.3   13  215-227   208-220 (422)
114 cd06161 S2P-M50_SpoIVFB SpoIVF  32.7      29 0.00062   29.4   1.8   19  214-232    37-55  (208)
115 KOG2414|consensus               31.7      18 0.00039   33.9   0.4   14  221-234   402-416 (488)
116 PF04450 BSP:  Peptidase of pla  30.3      99  0.0021   26.2   4.6   81  148-235    24-114 (205)
117 cd06159 S2P-M50_PDZ_Arch Uncha  29.8      33 0.00073   30.2   1.8   19  215-233   118-136 (263)
118 smart00731 SprT SprT homologue  29.6      29 0.00062   27.5   1.2   16  214-229    58-73  (146)
119 cd06160 S2P-M50_like_2 Unchara  29.5      35 0.00076   28.3   1.8   20  214-233    40-59  (183)
120 PF14247 DUF4344:  Domain of un  29.3      35 0.00077   29.2   1.8   13  215-227    92-104 (220)
121 TIGR02412 pepN_strep_liv amino  29.0      94   0.002   32.2   5.1   14  214-227   286-299 (831)
122 PF02130 UPF0054:  Uncharacteri  28.9      51  0.0011   26.2   2.5   19  215-233   108-126 (145)
123 KOG1046|consensus               28.6      92   0.002   32.6   4.9   15  213-227   322-336 (882)
124 PRK00016 metal-binding heat sh  28.0      48   0.001   26.9   2.2   20  215-234   113-132 (159)
125 TIGR00043 metalloprotein, YbeY  26.7      58  0.0013   24.6   2.4   21  214-234    72-92  (110)
126 PF10463 Peptidase_U49:  Peptid  26.3      46 0.00099   28.3   1.9   19  215-234   101-119 (206)
127 PRK04860 hypothetical protein;  26.2      32 0.00069   28.0   0.9   13  215-227    63-75  (160)
128 PRK04351 hypothetical protein;  26.0      38 0.00083   27.1   1.3   13  214-226    60-72  (149)
129 TIGR02411 leuko_A4_hydro leuko  25.7      35 0.00076   33.9   1.3   12  216-227   280-291 (601)
130 cd02640 R3H_NRF R3H domain of   25.7      44 0.00096   22.3   1.4   20  216-235    30-49  (60)
131 PF10026 DUF2268:  Predicted Zn  25.3 1.3E+02  0.0028   25.0   4.5   16  213-228    63-78  (195)
132 cd06007 R3H_DEXH_helicase R3H   25.3      47   0.001   22.1   1.4   20  216-235    29-48  (59)
133 COG0339 Dcp Zn-dependent oligo  24.6      28  0.0006   34.8   0.4   12  216-227   468-479 (683)
134 PRK10911 oligopeptidase A; Pro  24.5      37  0.0008   34.3   1.2   13  215-227   463-475 (680)
135 PF10263 SprT-like:  SprT-like   23.9      47   0.001   26.3   1.5   16  214-229    59-74  (157)
136 TIGR00744 ROK_glcA_fam ROK fam  23.4      28  0.0006   31.1   0.1   29  217-246   150-179 (318)
137 PLN02791 Nudix hydrolase homol  23.2      47   0.001   34.0   1.7   17  215-231   585-601 (770)
138 cd06162 S2P-M50_PDZ_SREBP Ster  22.3      56  0.0012   29.1   1.8   18  215-232   135-152 (277)
139 COG1940 NagC Transcriptional r  21.9      32  0.0007   30.7   0.2   32  217-250   159-190 (314)
140 PRK05082 N-acetylmannosamine k  20.6      38 0.00083   29.9   0.4   31  217-248   148-178 (291)
141 TIGR00054 RIP metalloprotease   20.2      60  0.0013   30.6   1.7   13  215-227    14-26  (420)
142 COG4823 AbiF Abortive infectio  20.2      54  0.0012   28.8   1.2   14  216-229    93-106 (299)

No 1  
>KOG3607|consensus
Probab=100.00  E-value=1.1e-55  Score=427.75  Aligned_cols=281  Identities=33%  Similarity=0.499  Sum_probs=245.0

Q ss_pred             CcccccccccccCCcceEEEeecccccCC--------ceEEeccCcc-ccccccccCCCCCC-CCCCCCCCCccccc---
Q psy1606           1 MLHCQHLSEKLEYGIETVAILSHSFLNPG--------GFIIPCRSAI-VDLGLNQVDPGLSP-DGARCGDGKTKRDT---   67 (285)
Q Consensus         1 ~~~c~y~g~~~~~~~~~v~~~~~~~~~~~--------~~i~p~~~~~-~~~~l~~~~~~~~~-~~~~Cg~~~~~~~~---   67 (285)
                      +.||||||++++++.|.||||||+|+ +|        |.|||++.+. +.+.+++.++.... ....||..+..+..   
T Consensus        93 ~~~C~YqG~v~g~~~S~vslStC~Gl-~g~~~~~~~~Y~Iepl~~s~~f~h~iy~~~~~~~~~~~~~~g~~~~~~~~~~~  171 (716)
T KOG3607|consen   93 QDHCYYQGYIEGEPDSFVSLSTCSGL-RGLFLFENISYSIEPLEGSDSFEHLIYKLLSLETDNSALVCGHQEAHIITKQM  171 (716)
T ss_pred             cccceeeeEeccccCceEEEEeccCc-ceeEEECceeEEEEECCCCCCcceeeeccccccccccccccccchhhcccccc
Confidence            57999999999999999999999999 44        9999999664 44455555554433 35789976443321   


Q ss_pred             ----ccccccccCCCCCcccceEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhcccccEEEEEEEEEEecCCCc
Q psy1606          68 ----VSKHDEIRGPYNANIKSRYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEKLNIFIALVGVVVWTEYDE  143 (285)
Q Consensus        68 ----~~~~~~~~~~~~~~~~~~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~~~i~v~l~~l~iw~~~~~  143 (285)
                          ....+..+.+..++.++||||++||+|+..|++++.+..++.++++.++|++|++|++++++|+|+++|+|+++|+
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~~kyvEl~vV~D~~~~~~~~~~~~~v~~~~~~vvn~~d~~y~~lni~i~lv~lE~Wt~~dk  251 (716)
T KOG3607|consen  172 ELPLRSKRQERREKRTVIEHTKYVELYVVVDNDLYKKYGSNLSKVRSFAKEVVNLVDSIYKQLNIRIVLVGLEIWTDGNK  251 (716)
T ss_pred             cccCcccccccccccccccccceEEEEEEEehHHHHHccccHHHHHHHHHHhhhHHhhhHhhccceEEEEEEEecCCCCe
Confidence                1112333335788999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCHHHHHHHHHHhhhhccCCCCCCCceeeeeeeecCCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHh
Q psy1606         144 ITLNVNGDITLTNFLSYRKDRLVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEM  223 (285)
Q Consensus       144 ~~~~~~~~~~l~~f~~w~~~~~~~~~~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHEl  223 (285)
                      +.+++++..+|.+|..|++..+..+.+||.|+|+++..+.+.++|+||+++||++.+++||+.+++..+...|.|+||||
T Consensus       252 i~~~~~~~~tL~~F~~wr~~~l~~r~~hD~a~L~~~~~~~~~~~G~a~~~~mCs~~~s~gv~~~~~~~~~~~a~v~Ahel  331 (716)
T KOG3607|consen  252 IDVSEDLRETLHNFLKWRKSYLTTRLPHDAAHLLSGILFYGKYVGLAYFGGMCSPGHSGGVNKFHSDILLAFAVVLAHEL  331 (716)
T ss_pred             ecccccHHHHHHHHHHHHHhhccccCCCCceEEEEeeeccCceeceeecccccCcccccceeecCcccchhHHHHHHHHH
Confidence            99989999999999999998888888999999999988889999999999999999999999999888888999999999


Q ss_pred             hhhcCCCCCCCCCCCC-CCCcccCCCCCCCCCCccCccCHHHHHhHhccCccccccccCc
Q psy1606         224 GHNLGMEHDTTECTCP-SDRCIMAPSSSSVSPTEWSSCSLEYLALSFDHGMDYCMRNKPK  282 (285)
Q Consensus       224 GH~lG~~HD~~~c~C~-~~~cIM~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~~~p~  282 (285)
                      ||+|||.||...|.|+ ...|||........+..||+||+++|+.++..+++.||+|.|.
T Consensus       332 gH~lGm~hD~~~c~C~~~~~CiM~~~~~~~~~~~FS~CS~~~~~~~~~~~~~~cl~n~p~  391 (716)
T KOG3607|consen  332 GHNLGMIHDESSCSCPSSGLCIMPEETGFYIPKKFSNCSYQDFESFLLKGGGSCLLNLPS  391 (716)
T ss_pred             HhhcCcccccccccCCCCCccccccccCcCcccccccchHHHHHHHHhcCCcceEecCCC
Confidence            9999999999999996 7889994444446789999999999999999999999999654


No 2  
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=100.00  E-value=1.5e-53  Score=361.27  Aligned_cols=197  Identities=39%  Similarity=0.677  Sum_probs=170.3

Q ss_pred             eEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhcccccEEEEEEEEEEecCCCcccccCCHHHHHHHHHHhhhhc
Q psy1606          85 RYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEKLNIFIALVGVVVWTEYDEITLNVNGDITLTNFLSYRKDR  164 (285)
Q Consensus        85 ~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~~~i~v~l~~l~iw~~~~~~~~~~~~~~~l~~f~~w~~~~  164 (285)
                      ||||++||+|+.+|++|+.|.+++++++++++|+||.+|++++++|+|++|+||+++|++.+..++..+|.+|++|++..
T Consensus         1 kyiEl~vvvD~~~~~~~~~n~~~~~~~~~~i~n~v~~~y~~l~i~v~l~~leiw~~~d~i~~~~~~~~~L~~F~~w~~~~   80 (199)
T PF01421_consen    1 KYIELLVVVDNSMYQYHGSNVTKVIQYVLTIVNIVDSIYQQLNIRVVLVGLEIWTEEDKINISNDADSTLENFCNWQKSE   80 (199)
T ss_dssp             EEEEEEEEE-HHHHHHTTTGHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEEEESSSTSS---SSHHHHHHHHHHHHHHT
T ss_pred             CeEEEEEEEeHHHHHHhcccHHHHHHHHHHHHHHHhhhcccCCeEEEEEEEEEcccCCceeeecchHHHHHHHHHHHHhh
Confidence            79999999999999999999999999999999999999999999999999999999999999889999999999999987


Q ss_pred             cCCCCCCCceeeeeeeecCCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCCCCCC-CCCC-CCCC
Q psy1606         165 LVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDTT-ECTC-PSDR  242 (285)
Q Consensus       165 ~~~~~~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~~-~c~C-~~~~  242 (285)
                      +.++.+||+|+|||+.++..++.|+|++|++|++.++++|+++.+..+..+|.++||||||+|||.||+. .|.| ++.+
T Consensus        81 ~~~~~~~D~a~Llt~~~~~~~~~G~a~~~~~C~~~~s~~i~~~~~~~~~~~a~~~AHelGH~lGm~HD~~~~C~C~~~~~  160 (199)
T PF01421_consen   81 LPPRIHHDHAHLLTGKDFPDSTVGLAYVGGMCSPSRSCGIVEDHSRSGLSFAVIIAHELGHNLGMPHDGDNGCKCPRRDG  160 (199)
T ss_dssp             HHHHS--SEEEEEESS-CSCCBSEEE-TT-TTSTTTSEEEEE-SSSSHHHHHHHHHHHHHHHTT---TTTCTHCSSSSSS
T ss_pred             cccccccceeEEeeecccccceeeeEeCCCCCCcCCCCcEeeeccchhHHHHHHHHHHHHHhcCCCCCCCCcCCcCCCCC
Confidence            7656789999999999997679999999999999999999999988888899999999999999999999 9999 6799


Q ss_pred             cccCCCCCCCCCCccCccCHHHHHhHhccCccccccccC
Q psy1606         243 CIMAPSSSSVSPTEWSSCSLEYLALSFDHGMDYCMRNKP  281 (285)
Q Consensus       243 cIM~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~~~p  281 (285)
                      |||++......+..||+||+++|.+++.++.+.||+|.|
T Consensus       161 cIM~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~n~P  199 (199)
T PF01421_consen  161 CIMSPSIGPSSSDKFSNCSRRQFEEFLSSGKSSCLLNKP  199 (199)
T ss_dssp             STTSSSSSSSSTSSS-HHHHHHHHHHHHHHTTGGGSS--
T ss_pred             ccccccccCCCCCCcCHHHHHHHHHHHccCCCCccCCCC
Confidence            999997765456799999999999999988899999998


No 3  
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=100.00  E-value=2.2e-51  Score=346.74  Aligned_cols=194  Identities=43%  Similarity=0.764  Sum_probs=182.9

Q ss_pred             eEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhcccccEEEEEEEEEEecCCCcccccCCHHHHHHHHHHhhhhc
Q psy1606          85 RYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEKLNIFIALVGVVVWTEYDEITLNVNGDITLTNFLSYRKDR  164 (285)
Q Consensus        85 ~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~~~i~v~l~~l~iw~~~~~~~~~~~~~~~l~~f~~w~~~~  164 (285)
                      ||||++|++|+.+|+++++|.++++++++.++|+||.+|++++|+|+|++|+||+++|++.+..++..+|..|.+|++..
T Consensus         1 ~~iE~~vv~D~~~~~~~~~n~~~~~~~v~~~~n~vn~~y~~~~i~v~l~~i~i~~~~~~~~~~~~~~~~L~~f~~w~~~~   80 (194)
T cd04269           1 KYVELVVVVDNSLYKKYGSNLSKVRQRVIEIVNIVDSIYRPLNIRVVLVGLEIWTDKDKISVSGDAGETLNRFLDWKRSN   80 (194)
T ss_pred             CeEEEEEEEeHHHHHHhCCCHHHHHHHHHHHHHHHHHHHcCCCeEEEEEEEEEeecCCcccccCCHHHHHHHHHHHHHHh
Confidence            58999999999999999999999999999999999999999999999999999999999988788899999999999987


Q ss_pred             cCCCCCCCceeeeeeeecCCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCCCCCCCCCCCCCCcc
Q psy1606         165 LVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDTTECTCPSDRCI  244 (285)
Q Consensus       165 ~~~~~~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~~~c~C~~~~cI  244 (285)
                      +..+.++|+++|||+++++++..|+||+|++|++.++++++++.+.++...|.++||||||+|||+||+..|.|++++||
T Consensus        81 ~~~~~~~D~a~Llt~~~~~~~~~G~A~~g~iC~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~~~c~C~~~~cI  160 (194)
T cd04269          81 LLPRKPHDNAQLLTGRDFDGNTVGLAYVGGMCSPKYSGGVVQDHSRNLLLFAVTMAHELGHNLGMEHDDGGCTCGRSTCI  160 (194)
T ss_pred             hccccCCCceEEEEeeecCCCceeeeecCCccCCCcceEEEEeCCcchHHHHHHHHHHHHhhcCCCcCCCCCCCCCCCeE
Confidence            76667899999999999988999999999999988899999999877778899999999999999999999999999999


Q ss_pred             cCCCCCCCCCCccCccCHHHHHhHhccCccccccc
Q psy1606         245 MAPSSSSVSPTEWSSCSLEYLALSFDHGMDYCMRN  279 (285)
Q Consensus       245 M~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~~  279 (285)
                      |++.... +++.||+||+++|++++..+.+.||++
T Consensus       161 M~~~~~~-~~~~fS~CS~~~~~~~l~~~~~~CL~~  194 (194)
T cd04269         161 MAPSPSS-LTDAFSNCSYEDYQKFLSRGGGQCLLN  194 (194)
T ss_pred             ecCCCCC-CCCCCChhhHHHHHHHHhcCCCCccCC
Confidence            9999875 689999999999999999988999975


No 4  
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=100.00  E-value=1.4e-47  Score=326.53  Aligned_cols=189  Identities=29%  Similarity=0.477  Sum_probs=169.1

Q ss_pred             eEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhccc----ccEEEEEEEEEEecCCCc-ccccCCHHHHHHHHHH
Q psy1606          85 RYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEK----LNIFIALVGVVVWTEYDE-ITLNVNGDITLTNFLS  159 (285)
Q Consensus        85 ~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~----~~i~v~l~~l~iw~~~~~-~~~~~~~~~~l~~f~~  159 (285)
                      ||||++||+|+.+|++++.  +++++|++.++|+||.+|++    ++|+|+|++|+||+++++ +.+..++..+|.+|++
T Consensus         1 ~~vEl~vv~D~~~~~~~~~--~~~~~y~~~~~n~v~~~y~~~s~~~~i~i~l~~i~i~~~~~~~~~~~~~~~~~L~~F~~   78 (207)
T cd04273           1 RYVETLVVADSKMVEFHHG--EDLEHYILTLMNIVASLYKDPSLGNSINIVVVRLIVLEDEESGLLISGNAQKSLKSFCR   78 (207)
T ss_pred             CeEEEEEEECHHHHHHcCh--HHHHHHHHHHHHHHHHHhcCcccCCCeEEEEEEEEEecCCCCcCcccCCHHHHHHHHHH
Confidence            5899999999999998753  78999999999999999996    799999999999998876 5566788999999999


Q ss_pred             hhhhccCCC----CCCCceeeeeeeecC-----CCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCC
Q psy1606         160 YRKDRLVLS----HPNDNAQLLTGMTFS-----DGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGME  230 (285)
Q Consensus       160 w~~~~~~~~----~~~D~a~llt~~~~~-----~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~  230 (285)
                      |++..+...    .++|+++|||+.++.     +++.|+||+||+|++.++++++++.+   ...|.++||||||+|||.
T Consensus        79 w~~~~~~~~~~~~~~~D~a~llt~~d~~~~~~~~~~~G~A~~ggiC~~~~s~~i~~~~~---~~~a~~~aHElGH~LG~~  155 (207)
T cd04273          79 WQKKLNPPNDSDPEHHDHAILLTRQDICRSNGNCDTLGLAPVGGMCSPSRSCSINEDTG---LSSAFTIAHELGHVLGMP  155 (207)
T ss_pred             HHHHcCCcccccccccceEEEEeeecccccCCCCCceEEeccccCCCCCcceEEEcCCC---ceeEEeeeeechhhcCCC
Confidence            998766553    479999999999985     58999999999999999999998864   345789999999999999


Q ss_pred             CCCCCCCCCCC---CcccCCCCCCC-CCCccCccCHHHHHhHhccCcccccc
Q psy1606         231 HDTTECTCPSD---RCIMAPSSSSV-SPTEWSSCSLEYLALSFDHGMDYCMR  278 (285)
Q Consensus       231 HD~~~c~C~~~---~cIM~~~~~~~-~~~~fS~CS~~~~~~~l~~~~~~CL~  278 (285)
                      ||+..|.|+..   +|||+|..... ++..||+||+++|+++++++.+.||+
T Consensus       156 HD~~~~~C~~~~~~~~IM~~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~  207 (207)
T cd04273         156 HDGDGNSCGPEGKDGHIMSPTLGANTGPFTWSKCSRRYLTSFLDTGDGNCLL  207 (207)
T ss_pred             CCCCCCCCCCCCCCceeecccccCCCCCCCcCHHHHHHHHHHHccCCCcccC
Confidence            99999999875   89999998763 68899999999999999998899995


No 5  
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=100.00  E-value=5.7e-45  Score=313.23  Aligned_cols=189  Identities=28%  Similarity=0.341  Sum_probs=164.0

Q ss_pred             EEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhcccc---cEEEEEEEEEEecCCCcccccC-------CHHHHHH
Q psy1606          86 YLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEKL---NIFIALVGVVVWTEYDEITLNV-------NGDITLT  155 (285)
Q Consensus        86 ~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~~---~i~v~l~~l~iw~~~~~~~~~~-------~~~~~l~  155 (285)
                      |||++||+|+.+|+++ ++.+++++|++.++|+||.+|+++   +|+|+|++|+||++++++.+..       +...+|.
T Consensus         2 yvEl~iV~D~~~~~~~-~~~~~~~~yv~~~~n~vn~~Y~~~~~p~I~i~lv~i~i~~~~~~~~~~~~~~~~~~~~~~tL~   80 (220)
T cd04272           2 YPELFVVVDYDHQSEF-FSNEQLIRYLAVMVNAANLRYRDLKSPRIRLLLVGITISKDPDFEPYIHPINYGYIDAAETLE   80 (220)
T ss_pred             cceEEEEecHHHHHhc-CCHHHHHHHHHHHHHHHHHHhhhcCCCcEEEEEEEEEeccCcccceeeccCCcccccHHHHHH
Confidence            7999999999999996 578999999999999999999988   8999999999999998876532       5678999


Q ss_pred             HHHHhhhhccCCCCCCCceeeeeeeec--------CCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhc
Q psy1606         156 NFLSYRKDRLVLSHPNDNAQLLTGMTF--------SDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNL  227 (285)
Q Consensus       156 ~f~~w~~~~~~~~~~~D~a~llt~~~~--------~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~l  227 (285)
                      +|++|++..+.. .++|+++|+|+.++        ..++.|+||+|++|++ ++++++++.+..+ ..|.++||||||+|
T Consensus        81 ~F~~~~~~~~~~-~~~D~~~LlT~~~~~~~~~g~~~~~~~G~A~~g~~C~~-~~~~~~~d~~~~~-~~~~~~AHElGH~l  157 (220)
T cd04272          81 NFNEYVKKKRDY-FNPDVVFLVTGLDMSTYSGGSLQTGTGGYAYVGGACTE-NRVAMGEDTPGSY-YGVYTMTHELAHLL  157 (220)
T ss_pred             HHHHHHhccCCC-CcccEEEEEeccceeeccCcccccCccceEeecCccCC-CceeEeecCCCCc-ccHHHHHHHHHHHh
Confidence            999999876544 48999999999987        2467899999999995 5788888876533 34799999999999


Q ss_pred             CCCCCCCC-C----------CCCC-CCcccCCCCCCCCCCccCccCHHHHHhHhccCcccccc
Q psy1606         228 GMEHDTTE-C----------TCPS-DRCIMAPSSSSVSPTEWSSCSLEYLALSFDHGMDYCMR  278 (285)
Q Consensus       228 G~~HD~~~-c----------~C~~-~~cIM~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~  278 (285)
                      ||+||+.+ |          .|+. .+|||++.....++..||+||+++|+++|..+.+.||.
T Consensus       158 G~~HD~~~~~~~~~~~~~~~~C~~~~~~IM~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~CL~  220 (220)
T cd04272         158 GAPHDGSPPPSWVKGHPGSLDCPWDDGYIMSYVVNGERQYRFSQCSQRQIRNVFRRLGASCLH  220 (220)
T ss_pred             CCCCCCCCCCccCCCCCccCcCCCCCCeEEeeccCCCCCCccCcchHHHHHHHHcCCCccccC
Confidence            99999865 4          5875 68999998776678899999999999999998899984


No 6  
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=100.00  E-value=7.3e-43  Score=294.29  Aligned_cols=182  Identities=33%  Similarity=0.511  Sum_probs=161.4

Q ss_pred             eEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhccc----ccEEEEEEEEEEecCCCcccc-cCCHHHHHHHHHH
Q psy1606          85 RYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEK----LNIFIALVGVVVWTEYDEITL-NVNGDITLTNFLS  159 (285)
Q Consensus        85 ~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~----~~i~v~l~~l~iw~~~~~~~~-~~~~~~~l~~f~~  159 (285)
                      ||||++||+|+.+|++|+++.+.++++++.++|+||.+|++    ++|++.|++|+||++.+++.. ..+...+|..|.+
T Consensus         1 ~~vE~~vv~D~~~~~~~~~~~~~~~~~i~~~in~vn~~y~~~~~~~~i~~~l~~i~i~~~~~~~~~~~~~~~~~l~~f~~   80 (192)
T cd04267           1 REIELVVVADHRMVSYFNSDENILQAYITELINIANSIYRSTNLRLGIRISLEGLQILKGEQFAPPIDSDASNTLNSFSF   80 (192)
T ss_pred             CEEEEEEEEcHHHHHHhcCCHHHHHHHHHHHHHHHHHHHhcCccCCCeEEEEEEEEEecCCCccCccCccHHHHHHHHHH
Confidence            68999999999999999989999999999999999999998    899999999999999988765 4567789999999


Q ss_pred             hhhhccCCCCCCCceeeeeeeec-CCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCCCCCCCC--
Q psy1606         160 YRKDRLVLSHPNDNAQLLTGMTF-SDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDTTEC--  236 (285)
Q Consensus       160 w~~~~~~~~~~~D~a~llt~~~~-~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~~~c--  236 (285)
                      |++..   ..++|+++|+|+.++ .+++.|+||++++|++.+++|++++.+. +...|.++||||||+|||.||+..|  
T Consensus        81 ~~~~~---~~~~d~~~l~t~~~~~~~~~~G~a~~~~~C~~~~~~~v~~~~~~-~~~~~~~~aHElGH~lG~~HD~~~~~~  156 (192)
T cd04267          81 WRAEG---PIRHDNAVLLTAQDFIEGDILGLAYVGSMCNPYSSVGVVEDTGF-TLLTALTMAHELGHNLGAEHDGGDELA  156 (192)
T ss_pred             HHhcC---CCCCceEEEEeeeccCCCCeeeeecccCCCCCCCCeEEEecCCc-ceeehhhhhhhHHhhcCCcCCCCCCcc
Confidence            98854   357999999999998 6789999999999999889999988765 4456899999999999999999754  


Q ss_pred             -CCC-CCCcccCCCCCCCCCCccCccCHHHHHhHhc
Q psy1606         237 -TCP-SDRCIMAPSSSSVSPTEWSSCSLEYLALSFD  270 (285)
Q Consensus       237 -~C~-~~~cIM~~~~~~~~~~~fS~CS~~~~~~~l~  270 (285)
                       .|+ +++|||++.....++..||+||+++|+++|.
T Consensus       157 ~~c~~~~~~IM~~~~~~~~~~~FS~CS~~~i~~~l~  192 (192)
T cd04267         157 FECDGGGNYIMAPVDSGLNSYRFSQCSIGSIREFLD  192 (192)
T ss_pred             ccCCCCCCeEEcccccCCCCCccChhhHHHHHHHhC
Confidence             555 5789999987755678999999999999873


No 7  
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup. The adamalysin_like or ADAM (A Disintegrin And Metalloprotease) family of metalloproteases are integral membrane proteases acting on a variety of extracellular targets. They are involved in shedding soluble peptides or proteins from the cell surface. This subfamily contains fungal ADAMs, whose precise function has yet to be determined.
Probab=100.00  E-value=9.1e-43  Score=299.64  Aligned_cols=186  Identities=27%  Similarity=0.390  Sum_probs=153.0

Q ss_pred             EEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhcc-cccEEEEEEEEEEecCCCccccc------------CCHHH
Q psy1606          86 YLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYE-KLNIFIALVGVVVWTEYDEITLN------------VNGDI  152 (285)
Q Consensus        86 ~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~-~~~i~v~l~~l~iw~~~~~~~~~------------~~~~~  152 (285)
                      .+=+.||+|+.+|++|+ +.+++++|+++++|+||.+|+ ++||+|.|++|+||+++|++.+.            .++..
T Consensus         2 ~~~~~vvaD~~~~~~~~-~~~~~~~~v~~ivN~vn~~Y~~~~nI~v~Lvglei~~~~d~~~~~~~~~~~~~~~~~~~~~~   80 (228)
T cd04271           2 VALIGVAADCSYTKSFG-SVEEARRNILNNVNSASQLYESSFNISLGLRNLTISDASCPSTAVDSAPWNLPCNSRIDIDD   80 (228)
T ss_pred             eEEEEEEechHHHHHcC-CHHHHHHHHHHHHHHHHHHhhCcceEEEEEEEEEEecCCCCCcccccccccccccccCCHHH
Confidence            34578999999999997 589999999999999999999 79999999999999998875432            35789


Q ss_pred             HHHHHHHhhhhccCCCCCCCce--eeeeeeecCCCceeccccCCCCcccccCceeecCCCchhHH-----HHHHHHHhhh
Q psy1606         153 TLTNFLSYRKDRLVLSHPNDNA--QLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLV-----ATTVAHEMGH  225 (285)
Q Consensus       153 ~l~~f~~w~~~~~~~~~~~D~a--~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~-----a~~~AHElGH  225 (285)
                      +|++|++|++...    .+|.+  +|+++... ++++|+||+|++|++..++++.++........     +.||||||||
T Consensus        81 tL~~F~~Wr~~~~----~~d~a~~~l~t~~~~-~~~lGlA~vg~mC~~~~s~~~~~~~~~~~~~~~~~~~~~t~AHElGH  155 (228)
T cd04271          81 RLSIFSQWRGQQP----DDGNAFWTLMTACPS-GSEVGVAWLGQLCRTGASDQGNETVAGTNVVVRTSNEWQVFAHEIGH  155 (228)
T ss_pred             HHHHHHHHHhcCC----CCCcEEeEeeccccC-CCceeEeeccCCCCCCcCCCccccccccceeecccccceehhhhhhh
Confidence            9999999988542    46666  99998764 78999999999999988878776543211111     2599999999


Q ss_pred             hcCCCCCCCC--CC---------CC--------CCCcccCCCCCCCCCCccCccCHHHHHhHhccCc--ccccc
Q psy1606         226 NLGMEHDTTE--CT---------CP--------SDRCIMAPSSSSVSPTEWSSCSLEYLALSFDHGM--DYCMR  278 (285)
Q Consensus       226 ~lG~~HD~~~--c~---------C~--------~~~cIM~~~~~~~~~~~fS~CS~~~~~~~l~~~~--~~CL~  278 (285)
                      ||||.||+..  |.         ||        +++|||+|..+. ++..||+||+++|++||..+.  +.||.
T Consensus       156 nLGm~HD~~~~~C~~~~~~~~~~Cp~~~~~C~~~~~~IM~~~~~~-~~~~FS~CS~~~~~~~l~~~~~~~~CL~  228 (228)
T cd04271         156 TFGAVHDCTSGTCSDGSVGSQQCCPLSTSTCDANGQYIMNPSSSS-GITEFSPCTIGNICSLLGRNPVRTSCLS  228 (228)
T ss_pred             hcCCCCCCCCCccccccccccccCCCcccccCCCCCEEeecCcCC-CCCccChhhHHHHHHHHhcCCCCCcccC
Confidence            9999999864  52         33        267999999876 789999999999999998754  88984


No 8  
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=100.00  E-value=2.2e-41  Score=294.39  Aligned_cols=193  Identities=20%  Similarity=0.343  Sum_probs=148.1

Q ss_pred             EEEEEEEEehHHHHHhcCC-hHHHHHHHHHHHHHHHhhcccccEE--------EEEEEEEEecCCCcccccCCHHHHHHH
Q psy1606          86 YLELVIVVDNRLYNLFNKN-SKLVHRHCKDISNVINALYEKLNIF--------IALVGVVVWTEYDEITLNVNGDITLTN  156 (285)
Q Consensus        86 ~vel~vv~D~~~~~~~~~n-~~~~~~~v~~~~n~v~~iy~~~~i~--------v~l~~l~iw~~~~~~~~~~~~~~~l~~  156 (285)
                      ++.|+||+|+.+|++++++ .+.+++++++++|+||.+|++++++        |.+.+++||++.+..........  ..
T Consensus         2 ~C~l~vVaD~~~~~~~~~~~~~~v~~~~~~~vn~vn~iY~~~n~~~~~l~~i~i~~~~i~I~~~~~~~~~~~~~~~--~~   79 (244)
T cd04270           2 TCKLLLVADHRFYKYMGRGEEETTINYLISHIDRVDDIYRNTDWDGGGFKGIGFQIKRIRIHTTPDEVDPGNKFYN--KS   79 (244)
T ss_pred             ccEEEEEEcHHHHHHhCCChHHHHHHHHHHHHHHHHHHhcccccCCCcccceEEEEEEEEEEcCcccccCCCcccc--cC
Confidence            4789999999999999987 7999999999999999999988765        66777777877665332111111  35


Q ss_pred             HHHhhhhccC-----CCCCCC--ceeeeeeeecCCCceeccccC--------CCCcccccC----------ceeec--CC
Q psy1606         157 FLSYRKDRLV-----LSHPND--NAQLLTGMTFSDGVVGKALKG--------PICTYEFSG----------GVNVD--HK  209 (285)
Q Consensus       157 f~~w~~~~~~-----~~~~~D--~a~llt~~~~~~~~~G~A~~g--------~~C~~~~~~----------~v~~~--~~  209 (285)
                      |..|+...+.     .+.++|  +|+|||+++|+++++|+||+|        |+|++..++          |++..  .+
T Consensus        80 f~~w~~~~~~~~~~~~~~~d~~c~A~LlT~~df~~~tlGlA~vg~~~~~~~gGIC~~~~s~~~~~~~~~n~gl~t~~~~~  159 (244)
T cd04270          80 FPNWGVEKFLVKLLLEQFSDDVCLAHLFTYRDFDMGTLGLAYVGSPRDNSAGGICEKAYYYSNGKKKYLNTGLTTTVNYG  159 (244)
T ss_pred             ccchhHHHHhhhhhhhcCCccceEEEEEeccccCCCceeeeeecccccCCCCcccCCcccccCCcceeeecceEeeeccC
Confidence            7666653332     233444  799999999988899999996        588886554          34322  22


Q ss_pred             C--chhHHHHHHHHHhhhhcCCCCCCC--CCCCCC---CCcccCCCCC---CCCCCccCccCHHHHHhHhccCccccccc
Q psy1606         210 N--VVGLVATTVAHEMGHNLGMEHDTT--ECTCPS---DRCIMAPSSS---SVSPTEWSSCSLEYLALSFDHGMDYCMRN  279 (285)
Q Consensus       210 ~--~~~~~a~~~AHElGH~lG~~HD~~--~c~C~~---~~cIM~~~~~---~~~~~~fS~CS~~~~~~~l~~~~~~CL~~  279 (285)
                      .  .+..+|.||||||||||||+||+.  .|.|+.   +.|||+|...   ..++..||+||+++|+++|..+.+.||.+
T Consensus       160 ~~~~~~~~a~t~AHElGHnlGm~HD~~~~~C~~~~~~~~~cIM~~~~~~~~~~~~~~FS~CS~~~~~~~L~~~~~~CL~~  239 (244)
T cd04270         160 KRVPTKESDLVTAHELGHNFGSPHDPDIAECAPGESQGGNYIMYARATSGDKENNKKFSPCSKKSISKVLEVKSNSCFVE  239 (244)
T ss_pred             CccchhHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCceEecCccccCCCCCCCCCCHhHHHHHHHHHccCCCCCcCC
Confidence            1  123367999999999999999998  577764   4899999863   25678999999999999999999999986


Q ss_pred             c
Q psy1606         280 K  280 (285)
Q Consensus       280 ~  280 (285)
                      .
T Consensus       240 ~  240 (244)
T cd04270         240 R  240 (244)
T ss_pred             C
Confidence            4


No 9  
>KOG3538|consensus
Probab=99.97  E-value=8e-30  Score=256.30  Aligned_cols=273  Identities=25%  Similarity=0.336  Sum_probs=201.3

Q ss_pred             cccccccccccCCcce-EEEeeccccc------CCceEEeccCccccc-----cccccCCCC---CCCCCCCCCCCcccc
Q psy1606           2 LHCQHLSEKLEYGIET-VAILSHSFLN------PGGFIIPCRSAIVDL-----GLNQVDPGL---SPDGARCGDGKTKRD   66 (285)
Q Consensus         2 ~~c~y~g~~~~~~~~~-v~~~~~~~~~------~~~~i~p~~~~~~~~-----~l~~~~~~~---~~~~~~Cg~~~~~~~   66 (285)
                      .+|+|+|.+.+.+.++ +|+++|.|.+      .-|+|+|+....-..     ++.+.....   .....-++..+....
T Consensus        82 ~~c~~~g~v~~~~~~~~~a~s~c~G~g~~~~~~~~~~iepl~~~~~~~~~~~~h~~~~r~~~~~~~~~~~~~~~~~~~~~  161 (845)
T KOG3538|consen   82 RGCFYLGDVLDCPPSAGAALSLCSGHGSIQLQGHDYFIEPLPRGPAAPVSGRAHLVYRRLDVELASEVLDGTRDQKCDPS  161 (845)
T ss_pred             CCCcccCcccCCCCccceeeeccCCccceeccCcceeEeeccCCCcccccCCCcccccchhhcccccCcccccccccccC
Confidence            5899999999988888 9999999931      229999998654111     111111000   000000000000011


Q ss_pred             cccccccccCC-CCCcccceEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhcccc----cEEEEEEEEEEecCC
Q psy1606          67 TVSKHDEIRGP-YNANIKSRYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEKL----NIFIALVGVVVWTEY  141 (285)
Q Consensus        67 ~~~~~~~~~~~-~~~~~~~~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~~----~i~v~l~~l~iw~~~  141 (285)
                      ........+-. +......+ ||.+|++|..+|.+++   ..+..|++.++|++..+|+.-    .|+|+++.++|+...
T Consensus       162 ~~~~~~~~~~~~~r~~~~~~-vetlvvaD~~~~~~~~---~~~~~~~lt~~n~v~~l~~~~sl~~~i~i~vvr~~~l~~~  237 (845)
T KOG3538|consen  162 PGDGAGRGRCRGRRSVSRHR-VETLVVADKCMVAFHG---ESVERYVLTLMNIVASLYKDPSLGNHINIVVVRLIILLKE  237 (845)
T ss_pred             Chhhccccccccccccccce-eeEEEEecHHHHHhcc---hhhHHHHHHHHHHHHHHhcCCCCCCceEEEEEEEEEEecC
Confidence            10000000000 12333444 9999999999999997   689999999999999999843    589999999999877


Q ss_pred             Cc-ccccCCHHHHHHHHHHhhhhccCCC--CCCCceeeeeeeecCC------CceeccccCCCCcccccCceeecCCCch
Q psy1606         142 DE-ITLNVNGDITLTNFLSYRKDRLVLS--HPNDNAQLLTGMTFSD------GVVGKALKGPICTYEFSGGVNVDHKNVV  212 (285)
Q Consensus       142 ~~-~~~~~~~~~~l~~f~~w~~~~~~~~--~~~D~a~llt~~~~~~------~~~G~A~~g~~C~~~~~~~v~~~~~~~~  212 (285)
                      +. ..+..++..+|++|++|+.......  ..+|.++|||+.++..      .+.|+|.++++|.+.+++.++++.+.. 
T Consensus       238 ~~~~~i~~~~~~sl~~fC~wq~~~n~~~d~~~~D~ailltr~d~~~~~~~~~~~~G~A~v~gmC~~~~sC~i~e~~gl~-  316 (845)
T KOG3538|consen  238 PSALNIEGNAGKSLDSFCKWQTSLNSEEDTEHHDHAILLTRQDFCEQQNGPCDTLGVAPVGGMCSPSRSCSINEDTGLP-  316 (845)
T ss_pred             CCCceeccCcccchhhhcccccccCCCccccccceeEEeeeeecccccCCCCccccceeecceeCCccceeeecCCCCc-
Confidence            65 5566778889999999988543332  3599999999998753      588999999999999999999998853 


Q ss_pred             hHHHHHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCCC-CCCCccCccCHHHHHhHhccCccccccccC
Q psy1606         213 GLVATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSSS-VSPTEWSSCSLEYLALSFDHGMDYCMRNKP  281 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~~-~~~~~fS~CS~~~~~~~l~~~~~~CL~~~p  281 (285)
                        .|+++|||+||+|||.||+....|.....||++.... .....||.||.+++.+||.++.+.||.+.|
T Consensus       317 --~aftiahE~GH~~gm~hd~~~~~C~~~~~im~~~~~~~~~~~~WS~CS~~~~t~fl~~~~~~Cl~d~p  384 (845)
T KOG3538|consen  317 --SAFTIAHELGHNFGMEHDGRGNSCGPTFHVMSSDTCGGNHELTWSECSREYLTRFLDDGEGNCLSDQP  384 (845)
T ss_pred             --cceeeeeccccccCcccCCcCCCCCCcccccCcccccCCCCccCCcchHHHHHHHhccCccceeecCC
Confidence              5799999999999999999876687766999999763 345579999999999999998889999887


No 10 
>KOG3658|consensus
Probab=99.97  E-value=9.4e-30  Score=237.45  Aligned_cols=273  Identities=21%  Similarity=0.284  Sum_probs=187.1

Q ss_pred             ccccccccCCcceEEEeecccccCC--------ceEEeccCcccccc-------ccccCCC----CCC---CCCCCCCCC
Q psy1606           5 QHLSEKLEYGIETVAILSHSFLNPG--------GFIIPCRSAIVDLG-------LNQVDPG----LSP---DGARCGDGK   62 (285)
Q Consensus         5 ~y~g~~~~~~~~~v~~~~~~~~~~~--------~~i~p~~~~~~~~~-------l~~~~~~----~~~---~~~~Cg~~~   62 (285)
                      +|-|++.+.+.|.|--+.-.|+..|        |-|||...-..+..       +++.+..    +.+   -...||..+
T Consensus       107 ~YtG~v~ge~~s~V~~~i~dg~~~g~I~t~~~~y~IEPa~~y~~d~~~p~~~viYke~di~~~~~~~~~~~~p~~~g~~k  186 (764)
T KOG3658|consen  107 FYTGHVVGEPASHVLASIEDGVFEGSIQTEGDTYYIEPAWRYFEDDKLPFHSVIYKESDIKNVHRLVATAGSPKVCGYSK  186 (764)
T ss_pred             eeeeEEecCcccceeEEEecCeEEEEEEecCceEEeccccccccCCCCccceEEEehhhhcchhhcccccCCCcccchhh
Confidence            5899999999999987777776333        88998775443321       2222211    112   135788776


Q ss_pred             cccccccccccccC-C--------------CCC-cccceEEEEEEEEehHHHHHhc-CChHHHHHHHHHHHHHHHhhccc
Q psy1606          63 TKRDTVSKHDEIRG-P--------------YNA-NIKSRYLELVIVVDNRLYNLFN-KNSKLVHRHCKDISNVINALYEK  125 (285)
Q Consensus        63 ~~~~~~~~~~~~~~-~--------------~~~-~~~~~~vel~vv~D~~~~~~~~-~n~~~~~~~v~~~~n~v~~iy~~  125 (285)
                      ..+.++....+... |              ... ...+.++.|+|++||.+|+++| .+.+.++.+++..+..||.||++
T Consensus       187 ~~~~el~~k~~~~~~p~n~~~~~~r~~R~~d~~~~~~kntC~LylqADh~fy~~mg~~t~e~~~~~l~~hI~rVn~IY~~  266 (764)
T KOG3658|consen  187 RRRRELLKKGEVDRIPPNELTANGRSKRRKDLLSDPMKNTCSLYLQADHRFYRYMGRGTRETTTNYLINHIDRVNEIYRN  266 (764)
T ss_pred             hhhhhcccccccccCChhhhhhhhhhhhhcccccccccceeeEEEEecHHHHHHHcCCchHHHHHHHHHHHHHHHHHhcC
Confidence            54433322111111 1              011 3446689999999999999998 35688899999999999999985


Q ss_pred             c---------cEEEEEEEEEEecCCCccccc-------CCHHHHHHHHHHhhhhccCCCCCCCceeeeeeeecCCCceec
Q psy1606         126 L---------NIFIALVGVVVWTEYDEITLN-------VNGDITLTNFLSYRKDRLVLSHPNDNAQLLTGMTFSDGVVGK  189 (285)
Q Consensus       126 ~---------~i~v~l~~l~iw~~~~~~~~~-------~~~~~~l~~f~~w~~~~~~~~~~~D~a~llt~~~~~~~~~G~  189 (285)
                      .         ||.++|..|.|.+..+..+-.       .....-+.+|.......  +....-+|+|||.++|.++++||
T Consensus       267 T~f~~~~g~kni~F~IkrIkI~~~~~~~~~~~~~~N~f~~e~~~v~~fl~l~s~~--~~sdfCLAylfT~rdFe~GtLGL  344 (764)
T KOG3658|consen  267 TNFDDRGGFKNIGFVIKRIKILDSPACVRPGEDHYNMFCEEVKDVLEFLSLNSEE--KHSDFCLAYLFTYRDFEGGTLGL  344 (764)
T ss_pred             CccccCCCccceEEEEEEEEecCchhhcccCcCccccchhhHHHHHHHhhhhhhc--cccchhheeeeeecccccceeee
Confidence            4         489999999999876532211       11233344444332211  12245689999999999999999


Q ss_pred             cccC--------CCCcccc--c--------CceeecCC--Cc--hhHHHHHHHHHhhhhcCCCCCCC-CCCCCC---CCc
Q psy1606         190 ALKG--------PICTYEF--S--------GGVNVDHK--NV--VGLVATTVAHEMGHNLGMEHDTT-ECTCPS---DRC  243 (285)
Q Consensus       190 A~~g--------~~C~~~~--~--------~~v~~~~~--~~--~~~~a~~~AHElGH~lG~~HD~~-~c~C~~---~~c  243 (285)
                      ||||        |||...+  .        .||+....  ..  +-..-.|+|||||||||++||.. +|..+.   +.|
T Consensus       345 AwVgsp~~~saGGIC~k~~~y~~G~~~sLNtGi~T~~NYg~~Vp~kvs~lt~AHEiGHNfGSpHDp~~ECsPg~~~~Gny  424 (764)
T KOG3658|consen  345 AWVGSPRSNSAGGICEKAYTYNEGKKRSLNTGISTSVNYGKRVPTKVSDLTLAHEIGHNFGSPHDPDIECSPGESQGGNY  424 (764)
T ss_pred             EEeccCccCCCCcccccceeccCcceEEeecceeeeeecCCccCcchhheeehhhhccccCCCCCCCCccCCCCCCCCcE
Confidence            9986        6888642  2        23333221  11  11234799999999999999987 788754   679


Q ss_pred             ccCCCCCC---CCCCccCccCHHHHHhHhccCccccccc
Q psy1606         244 IMAPSSSS---VSPTEWSSCSLEYLALSFDHGMDYCMRN  279 (285)
Q Consensus       244 IM~~~~~~---~~~~~fS~CS~~~~~~~l~~~~~~CL~~  279 (285)
                      ||++++..   .+..+||+||++.|..+|..++..|+..
T Consensus       425 iM~a~AtSGd~~NN~kFSpCS~ksI~~VL~~k~~~CFqE  463 (764)
T KOG3658|consen  425 IMYAYATSGDKPNNKKFSPCSLKSISKVLESKKRNCFQE  463 (764)
T ss_pred             EEEEecccCcCccCcccCcchHHHHHHHHHHhhhhhccC
Confidence            99999863   6788999999999999999988899974


No 11 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=99.96  E-value=6.4e-29  Score=209.93  Aligned_cols=171  Identities=32%  Similarity=0.456  Sum_probs=106.2

Q ss_pred             ceEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHH-HhhcccccEEEEEEEEEEecCCCccc-----ccCCHHHHHHHH
Q psy1606          84 SRYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVI-NALYEKLNIFIALVGVVVWTEYDEIT-----LNVNGDITLTNF  157 (285)
Q Consensus        84 ~~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v-~~iy~~~~i~v~l~~l~iw~~~~~~~-----~~~~~~~~l~~f  157 (285)
                      .++|||+|++|+.+++.|+++ .+++.++..+++.| +.+|++.+|++.|++|+||+..++..     ...+...+|+.|
T Consensus         2 ~~t~~l~v~~D~~f~~~~~~~-~~~~~~i~~~~~~v~n~~~~~~~I~~~i~~i~i~~~~~~~~~~~~~~~~~~~~~L~~f   80 (196)
T PF13688_consen    2 KTTCELLVVADYEFYQAFGSD-QAVISYIASLFNQVSNLYYRTSNIQFQISGITIWTSSDPYTNNVSNSNIDAEDTLQDF   80 (196)
T ss_dssp             SEEEEEEEEE-HHHHHHTST--HHHHHHHHHHHHHHHHHHHT----EEEEEEEEE--S-B---TT-TSSS--HHHHHHHH
T ss_pred             ceEEEEEEEEcHHHHHHhCCc-HHHHHHHHHHHHHHHHHHhhccCceEEEEEEEEecCCCCCcccccccccCHHHHHHHH
Confidence            478999999999999999873 38999999999999 88888999999999999999887643     235678999999


Q ss_pred             HHhhhhccCCCCCCCceeeeeeeecCCCceeccccCCCCcccccCceeecCC------CchhHHHHHHHHHhhhhcCCCC
Q psy1606         158 LSYRKDRLVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHK------NVVGLVATTVAHEMGHNLGMEH  231 (285)
Q Consensus       158 ~~w~~~~~~~~~~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~------~~~~~~a~~~AHElGH~lG~~H  231 (285)
                      ..+..... .....|+++|||++++.++ +|+||+|++|......++.....      ......+.++||||||+||+.|
T Consensus        81 ~~~~~~~~-~~~~~dl~~l~t~~d~~~g-lGlA~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AHEiGH~lGa~H  158 (196)
T PF13688_consen   81 NNDFSSWR-DSSYYDLAHLFTGRDFSGG-LGLAYVGSSCSNTSGGICSSSVSGSYGQVPPTYNGAITFAHEIGHNLGAPH  158 (196)
T ss_dssp             --HHHTHH-HHTTSSEEEEEE----GGG-EEEESSSSSSTT-SSSSS--E-EEETTEE--HHHHHHHHHHHHHHHTT---
T ss_pred             hhhhhhcc-CCCCCCEEEEEecccCCCC-ceeEeccccCcCCccceeccCcccccceECCCCceehhhHHhHHHhcCCCC
Confidence            53333211 1235799999999999666 99999999999775555554411      1234567999999999999999


Q ss_pred             CCCC------CC-----CC-CCCcccCCCCCCCCCCccC
Q psy1606         232 DTTE------CT-----CP-SDRCIMAPSSSSVSPTEWS  258 (285)
Q Consensus       232 D~~~------c~-----C~-~~~cIM~~~~~~~~~~~fS  258 (285)
                      |+..      |.     |+ .++|||+|... ++..+||
T Consensus       159 D~~~~~~~~~c~~~~~~~~~~~~~IM~y~~~-~n~~~FS  196 (196)
T PF13688_consen  159 DGDYSSTSSSCPPSSSTCPAGGGYIMSYCAS-PNNNKFS  196 (196)
T ss_dssp             --SSS---TTTS-----GGGT---TTSSS---GGGGS--
T ss_pred             CCCCCCCCCCCCCCccccCCCCCeEEcccCC-CCcccCC
Confidence            9863      32     33 36899999988 6678887


No 12 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=99.91  E-value=1.4e-23  Score=178.26  Aligned_cols=186  Identities=28%  Similarity=0.364  Sum_probs=133.6

Q ss_pred             ceEEEEEEEEehHHHHHh-cCChHHHHHHHHHHHHHHHhhcc-cccEEEEEEE--EEEecCC--Cccccc----CCHHHH
Q psy1606          84 SRYLELVIVVDNRLYNLF-NKNSKLVHRHCKDISNVINALYE-KLNIFIALVG--VVVWTEY--DEITLN----VNGDIT  153 (285)
Q Consensus        84 ~~~vel~vv~D~~~~~~~-~~n~~~~~~~v~~~~n~v~~iy~-~~~i~v~l~~--l~iw~~~--~~~~~~----~~~~~~  153 (285)
                      .|.++|+|++|+.+++.| +++.+.++.++..+++.+|++|. .++|++.|+.  ..+.++.  +.+.-.    .-.+..
T Consensus         2 ~~~~~l~v~~d~~~~~~~~~~s~~~v~~~i~~~v~~~N~~Y~s~v~i~~~Lv~~~~~~~t~s~~~~~~~~~~~~~~~~~~   81 (206)
T PF13583_consen    2 LRVYRLAVVYDYSFYSWFFGGSIEDVKAFIASMVNFANEAYNSDVGIRFRLVHDEQLIYTESSSDDYNDLTSARYTLNNA   81 (206)
T ss_pred             ceEEEEEEEECHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHhcCCCCEEEEeccccceecccccccccccchhhhhhhHH
Confidence            468999999999999999 57899999999999999999995 6778877764  3344443  222110    112356


Q ss_pred             HHHHHHhhhhccCCCCCCCceeeeeeeecCCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCCCCC
Q psy1606         154 LTNFLSYRKDRLVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       154 l~~f~~w~~~~~~~~~~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~  233 (285)
                      +..|..|+.     ...+|++++++......+..|+||+++.|..+..+++..+...... ...++||||||+||+.||.
T Consensus        82 ~~~~~~~~~-----~~~~D~v~l~~~~~~~~~~~GlA~~~~~~~~~~~~~~~~~~~~~~~-~~~~~aHEiGH~lGl~H~~  155 (206)
T PF13583_consen   82 LATFNSWRG-----SKNADLVILLTDTNKDSGTCGLAYVGSVCWDNAKAGAYSDPDLSAN-GYQTFAHEIGHNLGLRHDF  155 (206)
T ss_pred             HHHHHHHhc-----ccCCCEEEEEeccccCCCCCCeeeeccccccccceEEEEecccccc-cchHHHHHHHHHhcCCCCc
Confidence            667777765     2478999999977544788999999999955544455444311111 1267999999999999998


Q ss_pred             CC--------CCCCCCCcccCCCCCCCCCCccCccCHHHHHhHhccCcccc
Q psy1606         234 TE--------CTCPSDRCIMAPSSSSVSPTEWSSCSLEYLALSFDHGMDYC  276 (285)
Q Consensus       234 ~~--------c~C~~~~cIM~~~~~~~~~~~fS~CS~~~~~~~l~~~~~~C  276 (285)
                      ..        +.|.++..||++..... ...||+||+.++++++..+...|
T Consensus       156 ~~~~~~~~~~~~~~~~~tIMsY~~~~~-~~~FS~~~i~~i~~~~~~~~~~~  205 (206)
T PF13583_consen  156 DYSGDPYSYAYECDSGQTIMSYASRPS-RPYFSPPSIEYIREVVICGDASY  205 (206)
T ss_pred             ccCCCcccccccCCCCCEEeCCCCCCC-CCCCCchhHHHHhCCCcCccccc
Confidence            42        34445679999754433 34599999999999887766555


No 13 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=99.90  E-value=1.1e-23  Score=173.26  Aligned_cols=148  Identities=26%  Similarity=0.374  Sum_probs=121.7

Q ss_pred             eEEEEEEEEehHHHHHhcCChHHHHHHHHHHHHHHHhhccc-ccEEEEEEEEEEecCCCcccccCCHHHHHHHHHHhhhh
Q psy1606          85 RYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEK-LNIFIALVGVVVWTEYDEITLNVNGDITLTNFLSYRKD  163 (285)
Q Consensus        85 ~~vel~vv~D~~~~~~~~~n~~~~~~~v~~~~n~v~~iy~~-~~i~v~l~~l~iw~~~~~~~~~~~~~~~l~~f~~w~~~  163 (285)
                      |+||+.|++|+.+|     +.+.+..++..+++.++.+|++ .+|++.++..++                          
T Consensus         1 ~~i~~~i~~d~~~~-----~~~~~~~~~~~~v~~a~~~w~~~~~i~f~~~~~~~--------------------------   49 (167)
T cd00203           1 KVIPYVVVADDRDV-----EEENLSAQIQSLILIAMQIWRDYLNIRFVLVGVEI--------------------------   49 (167)
T ss_pred             CEEEEEEEeccccc-----chhhhHHHHHHHHHHHHHHHHhhhCceEEEeccCC--------------------------
Confidence            58999999999998     4578888999999999999987 789888776543                          


Q ss_pred             ccCCCCCCCceeeeeeeecCCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCCCCCCCCC------
Q psy1606         164 RLVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDTTECT------  237 (285)
Q Consensus       164 ~~~~~~~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~~~c~------  237 (285)
                           .++|+++++++.++.++..|.|++++.|++..+.++...........+.++||||||.|||.||...|.      
T Consensus        50 -----~~~di~~~~~~~~~~~~~~g~a~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~HElGH~LGl~H~~~~~~~~~~~~  124 (167)
T cd00203          50 -----DKADIAILVTRQDFDGGTGGWAYLGRVCDSLRGVGVLQDNQSGTKEGAQTIAHELGHALGFYHDHDRKDRDDYPT  124 (167)
T ss_pred             -----CcCcEEEEeccccCCCCceEEEecCCccCCCCCcEEEecCCcccccchhhHHHHHHHHhCCCccCcCCCCCCCcc
Confidence                 368999999988876778999999999998777777655443233457899999999999999997654      


Q ss_pred             --------CCCCCcccCCCCCC---CCCCccCccCHHHHHhH
Q psy1606         238 --------CPSDRCIMAPSSSS---VSPTEWSSCSLEYLALS  268 (285)
Q Consensus       238 --------C~~~~cIM~~~~~~---~~~~~fS~CS~~~~~~~  268 (285)
                              |.+..|||++....   .....||+||+++|+++
T Consensus       125 ~~~~~~~~~~~~~siM~y~~~~~~~~~~~~fS~~d~~~i~~~  166 (167)
T cd00203         125 IDDTLNAEDDDYYSVMSYTKGSFSDGQRKDFSQCDIDQINKL  166 (167)
T ss_pred             ccccccCCCCCCCeEeccCccccCcccCCCcCHHHHHHHHhh
Confidence                    33478999998864   36789999999999875


No 14 
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=99.90  E-value=7.2e-25  Score=181.33  Aligned_cols=154  Identities=30%  Similarity=0.462  Sum_probs=50.8

Q ss_pred             HHHHHHHHHHHHHHhhcc-cccEEEEEEE--EEEecCC--CcccccCCH----HHHHHHHHHhhhhccCCCCCCCceeee
Q psy1606         107 LVHRHCKDISNVINALYE-KLNIFIALVG--VVVWTEY--DEITLNVNG----DITLTNFLSYRKDRLVLSHPNDNAQLL  177 (285)
Q Consensus       107 ~~~~~v~~~~n~v~~iy~-~~~i~v~l~~--l~iw~~~--~~~~~~~~~----~~~l~~f~~w~~~~~~~~~~~D~a~ll  177 (285)
                      +++.++..++|.||.+|+ ++++++.|+.  .+|.++.  +++....+.    ...+..|..|..     ...+|+++++
T Consensus         2 ~~~a~i~~~vn~vN~iY~~d~~i~~~lv~~~~~i~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~Di~~l~   76 (173)
T PF13574_consen    2 NALAAIVTTVNRVNQIYERDINIRLELVNNDRIIFTDPSTDPYNNNCNGGNLISENQANFDSWIG-----SSNYDIGHLF   76 (173)
T ss_dssp             -----------------------------------------------------------------------TCSS-CCEE
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCC-----CCCCCEEEEe
Confidence            567889999999999997 6777776653  2333332  222221111    122334444433     2379999999


Q ss_pred             eeeecCCCceeccccCCCCcccccC-ceeecCCCchhHHHHHHHHHhhhhcCCCCCCCCC------CCCC-CCcccCCCC
Q psy1606         178 TGMTFSDGVVGKALKGPICTYEFSG-GVNVDHKNVVGLVATTVAHEMGHNLGMEHDTTEC------TCPS-DRCIMAPSS  249 (285)
Q Consensus       178 t~~~~~~~~~G~A~~g~~C~~~~~~-~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~~~c------~C~~-~~cIM~~~~  249 (285)
                      .  .+.++..|+||+|++|+..+.. |+....+..+  ...++||||||+||++||...+      .|+. +++||++. 
T Consensus        77 ~--~~~~g~~Gla~~g~~c~~~~~~~g~~~~~~~~~--~~~~~aHElGH~lGa~Hd~~~~~~~~~~~~~~sg~~IMsy~-  151 (173)
T PF13574_consen   77 G--TFSGGGGGLAYVGGVCSKGYKATGLSSPYGDFF--GIDTFAHELGHQLGAPHDFDNGCNPGSPTCPGSGGYIMSYA-  151 (173)
T ss_dssp             E--EESSGCCSSEEE-CCCCTCCCE-CCCS--TTSH--HHHHHHHHHHHHHT---SSSS----SS--T-STTT-TT-SS-
T ss_pred             e--ccCCCCccEEEEeEeCcCCCEEEEEEcCCCcee--eeeeehhhhHhhcCCCCCCCCCCCCCCCcCCCCCCEEEeeC-
Confidence            3  3357899999999999876543 4443333223  4678999999999999998642      4554 78999977 


Q ss_pred             CCCCCCccCccCHHHHHhHhc
Q psy1606         250 SSVSPTEWSSCSLEYLALSFD  270 (285)
Q Consensus       250 ~~~~~~~fS~CS~~~~~~~l~  270 (285)
                      +..+.+.||+||+++|+.+|.
T Consensus       152 ~~~~~~~fS~cS~~~i~~~l~  172 (173)
T PF13574_consen  152 GICNNDKFSPCSIRQIRAVLG  172 (173)
T ss_dssp             -GGGG----------------
T ss_pred             CCCCCcccccccccccccccC
Confidence            545678999999999999986


No 15 
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=99.79  E-value=1.3e-19  Score=141.89  Aligned_cols=122  Identities=31%  Similarity=0.399  Sum_probs=78.0

Q ss_pred             HHHHHHHHHHHhhcc-cccEEEEEEEEEEecCCCcccccCCHHHHHHHHHHhhhhccCCCCCCCceeeeeeeecCCCcee
Q psy1606         110 RHCKDISNVINALYE-KLNIFIALVGVVVWTEYDEITLNVNGDITLTNFLSYRKDRLVLSHPNDNAQLLTGMTFSDGVVG  188 (285)
Q Consensus       110 ~~v~~~~n~v~~iy~-~~~i~v~l~~l~iw~~~~~~~~~~~~~~~l~~f~~w~~~~~~~~~~~D~a~llt~~~~~~~~~G  188 (285)
                      .++..+++.+|++|+ +++|++.|+++.+|+..+......+....|..+..+..........+|++++|+..++ .+..|
T Consensus         2 ~~i~~~v~~~n~~y~~~~~i~l~l~~i~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~aD~v~~~~~~~~-~~~~G   80 (124)
T PF13582_consen    2 AYINALVNRANQAYESNSGIRLRLVGIIYTDYSDDPSSSSDSNSTLDNFYASFDARDRDQYGADLVHLFTGNDL-NGAGG   80 (124)
T ss_dssp             -----HHHHHHHHHTTTGGGTEEEEEEEEE-S-----SSS-HHHHHHHHHHHHHC--GGGTT-TTSEEEEEESS-GGB-E
T ss_pred             chHHHHHHHHHHHHHhCCCcEEEEEEEEEeccccccccCccHHHHHHHHHHhhhhhccccCCCCEEEEeccCCC-CCCce
Confidence            467788999999999 8899999999999998876655567788999998886543233457999999998876 67899


Q ss_pred             ccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCCCC
Q psy1606         189 KALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHD  232 (285)
Q Consensus       189 ~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD  232 (285)
                      +||++++|.+.+..++.............++||||||+||+.||
T Consensus        81 ~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HEiGH~lGl~Hd  124 (124)
T PF13582_consen   81 IAYIGGVCSNNSGYGVNYDSSPYGDSGVDTFAHEIGHNLGLNHD  124 (124)
T ss_dssp             EEECT---TTT--TT-SEEEEE--TTSTTHHHHHHHHHTT----
T ss_pred             EEEeCCccccCCceEEEcccCCCCcccceEeeehhhHhcCCCCC
Confidence            99999999998777777665211122247999999999999998


No 16 
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=98.94  E-value=5.6e-09  Score=86.40  Aligned_cols=73  Identities=29%  Similarity=0.391  Sum_probs=58.5

Q ss_pred             CCCceeeeeeeecCCCceeccccCCCCcccccCceeecCCCchh-------------HHHHHHHHHhhhhcCCCCCCCCC
Q psy1606         170 PNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVG-------------LVATTVAHEMGHNLGMEHDTTEC  236 (285)
Q Consensus       170 ~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~-------------~~a~~~AHElGH~lG~~HD~~~c  236 (285)
                      ..+.++.+|..|...  .|.+|+.|.|.+..+++|+........             .+...++||+||+|||.|     
T Consensus        69 ~~~~vl~vt~~DLy~--~~~nfvfG~a~~~~~~aVvS~~Rl~~~~~~~~~~~~l~~~R~~k~~~HElGH~lGL~H-----  141 (179)
T PRK13267         69 NGDKNIGITDCDLYY--RGLNFVFGLAYPNLRGAVISTYRLRPEFYGNKPDSELFEERVRKEVTHELGHTLGLEH-----  141 (179)
T ss_pred             CCceEEEEEccccCC--CCCCceeEEeecCCCEEEEEccccChhhccccchHHHHHHHHHHHHHHHHHHHcCCcc-----
Confidence            578899999888743  589999999999888888877653221             245669999999999999     


Q ss_pred             CCCCCCcccCCCCC
Q psy1606         237 TCPSDRCIMAPSSS  250 (285)
Q Consensus       237 ~C~~~~cIM~~~~~  250 (285)
                       |....|+|+...+
T Consensus       142 -C~~~~CvM~~s~s  154 (179)
T PRK13267        142 -CDNPRCVMNFSNS  154 (179)
T ss_pred             -CCCCCccCCCCCC
Confidence             7778999997654


No 17 
>PF07998 Peptidase_M54:  Peptidase family M54;  InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry represents zinc-dependent peptidases belonging to the MEROPS peptidase family M54, more commonly known as the archaemetzincins. The family has a wide taxonomic distribution, being found in archaea, bacteria and eukaryotes. Two human homologues have been characterised []. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 3LMC_A 2XHQ_A 2X7M_A.
Probab=98.39  E-value=5.7e-07  Score=75.04  Aligned_cols=67  Identities=24%  Similarity=0.333  Sum_probs=36.9

Q ss_pred             eeeeeeecCCCceeccccCCCCcccccCceeecCC-----Cc----hhHHHHHHHHHhhhhcCCCCCCCCCCCCCCCccc
Q psy1606         175 QLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHK-----NV----VGLVATTVAHEMGHNLGMEHDTTECTCPSDRCIM  245 (285)
Q Consensus       175 ~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~-----~~----~~~~a~~~AHElGH~lG~~HD~~~c~C~~~~cIM  245 (285)
                      ..+|..|..  ..|+.++-|.-.+....+|.....     .+    ...+...++||+||.||+.|      |.. .|+|
T Consensus        98 l~it~~DlY--~~~~nfVFG~A~~~~~~aVvS~~~~~fy~~~~~l~~~R~~Kea~HElGH~~GL~H------C~~-~CvM  168 (194)
T PF07998_consen   98 LGITDRDLY--SPGLNFVFGLARPGGGVAVVSTSRNEFYGEDEELFLERVCKEAVHELGHLFGLDH------CEN-RCVM  168 (194)
T ss_dssp             EEEESS-EE--ETTESEBSEEEECCSSEEEEEGGCGGGGTSSHHHHHHHHHHHHHHHHHHHTT----------SS-TSTT
T ss_pred             EEEeccccC--CCCCceEEEEeecCCCeEEEEEeccccccccHHHHHHHHHHHHHHHHHHHcCCcC------CCC-CCcc
Confidence            666766652  234444444444333444543322     12    23467899999999999999      888 9999


Q ss_pred             CCCCC
Q psy1606         246 APSSS  250 (285)
Q Consensus       246 ~~~~~  250 (285)
                      ++..+
T Consensus       169 ~~s~s  173 (194)
T PF07998_consen  169 NFSNS  173 (194)
T ss_dssp             S--SS
T ss_pred             CCCCC
Confidence            98654


No 18 
>PF01562 Pep_M12B_propep:  Reprolysin family propeptide;  InterPro: IPR002870 This signature covers the region of the propeptide for members of the MEROPS peptidase family M12B (clan MA(M), adamalysin family). The propeptide contains a sequence motif similar to the "cysteine switch" of the matrixins, which mediate cell-cell or cell-matrix interactions.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis
Probab=98.02  E-value=2.6e-06  Score=67.06  Aligned_cols=36  Identities=25%  Similarity=0.146  Sum_probs=31.4

Q ss_pred             cccccccccccCCcceEEEeecccccCC--------ceEEeccCc
Q psy1606           2 LHCQHLSEKLEYGIETVAILSHSFLNPG--------GFIIPCRSA   38 (285)
Q Consensus         2 ~~c~y~g~~~~~~~~~v~~~~~~~~~~~--------~~i~p~~~~   38 (285)
                      .+|+|+|++.+.+.|.||+|+|.|| .|        |+|||++..
T Consensus        77 ~~c~Y~G~V~g~~~S~vals~c~gl-~G~i~~~~~~y~IeP~~~~  120 (131)
T PF01562_consen   77 EHCHYQGHVEGDPGSSVALSLCGGL-RGVIQTDDETYFIEPLPRY  120 (131)
T ss_pred             cceEEEeeeCCCCCCEEEEEECCce-EEEEEECCEEEEEEECCcC
Confidence            5899999999999999999999887 44        889998644


No 19 
>COG1913 Predicted Zn-dependent proteases [General function prediction only]
Probab=97.93  E-value=4.1e-06  Score=67.70  Aligned_cols=50  Identities=40%  Similarity=0.699  Sum_probs=36.1

Q ss_pred             HHHHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCCC--CCCCccCccC--HHHHHhHhc
Q psy1606         215 VATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSSS--VSPTEWSSCS--LEYLALSFD  270 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~~--~~~~~fS~CS--~~~~~~~l~  270 (285)
                      +-.-+.||+||.||+.|      |+...|+|+...+.  ..-+.|+-|.  ++.++..+.
T Consensus       124 v~KEv~HElGH~~GL~H------C~N~~CVM~FSnSl~dvDrKs~~fC~~C~~kL~~~l~  177 (181)
T COG1913         124 VVKEVLHELGHLLGLSH------CPNPRCVMNFSNSLRDVDRKSPNFCNSCLRKLERKLK  177 (181)
T ss_pred             HHHHHHHHhhhhcCccc------CCCCCcEEeCCccHHhhhccchhhhHHHHHHHHHhhc
Confidence            45789999999999999      99999999998762  2334454443  455555443


No 20 
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.
Probab=97.72  E-value=9.1e-05  Score=63.73  Aligned_cols=117  Identities=19%  Similarity=0.178  Sum_probs=61.9

Q ss_pred             HHHHHHHHHHHhhccc------ccEEEEEEEEEEecCCCccc-ccCCHHHHHHHHHHhhhhccCCCCCCCceeeeeeeec
Q psy1606         110 RHCKDISNVINALYEK------LNIFIALVGVVVWTEYDEIT-LNVNGDITLTNFLSYRKDRLVLSHPNDNAQLLTGMTF  182 (285)
Q Consensus       110 ~~v~~~~n~v~~iy~~------~~i~v~l~~l~iw~~~~~~~-~~~~~~~~l~~f~~w~~~~~~~~~~~D~a~llt~~~~  182 (285)
                      ..+...+..+|..|+.      .+|++.|.++.=-....... .....+..++....|-       ....+-+.+... .
T Consensus        25 ~~i~~qi~vlN~~y~~~~~~~~~~i~F~Lagi~r~~n~~~~~~~~~~~~~~~k~~l~~~-------~~~~LNIy~~~~-~   96 (225)
T cd04275          25 AQITDQIDVLNDDYSGLNAGVDLGIEFVLAGTTRTVNSAWPVFAGSGTEDAMKSALRKG-------GYKYLNIYVANF-L   96 (225)
T ss_pred             HHHHHHHHHHHHHhhccccCCCCceEEEEeeeEEecCCCcccccCcchHHHHHHHhccC-------CcCeEEEEEECC-C
Confidence            3566778889999998      89999999864322222221 1112222333222111       112233333222 1


Q ss_pred             CCCceeccccCCCCccc--ccCceeecCCC------chhHHHHHHHHHhhhhcCCCCCCC
Q psy1606         183 SDGVVGKALKGPICTYE--FSGGVNVDHKN------VVGLVATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       183 ~~~~~G~A~~g~~C~~~--~~~~v~~~~~~------~~~~~a~~~AHElGH~lG~~HD~~  234 (285)
                      .++.+|.|+.-..-...  ..-||+.....      .....+.|++||+||-|||.|.-.
T Consensus        97 ~~~~lG~a~fP~~~~~~~~~~dGvvi~~~~~~~~~~~~~n~g~t~~HEvGH~lGL~HtF~  156 (225)
T cd04275          97 GGGLLGYATFPDSLVSLAFITDGVVINPSSLPGGSAAPYNLGDTATHEVGHWLGLYHTFQ  156 (225)
T ss_pred             CCCcCEEEECCCcccCCccccceEEEeccccCCCCcccccccceeEEeccceeeeeeeec
Confidence            35677888754433321  12244433211      012235799999999999999754


No 21 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=97.72  E-value=3.7e-05  Score=61.90  Aligned_cols=48  Identities=21%  Similarity=0.401  Sum_probs=34.6

Q ss_pred             HHHHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCCCCCCCccCccCHHHHHhH
Q psy1606         215 VATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSSSVSPTEWSSCSLEYLALS  268 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~~~~~~~fS~CS~~~~~~~  268 (285)
                      +-.|++|||||.|||.|...      ..-||+|.........++..-+.-++.+
T Consensus       105 ~~~v~~HEiGHaLGL~H~~~------~~svM~~~~~~~~~~~l~~~Di~~i~~l  152 (154)
T PF00413_consen  105 LQSVAIHEIGHALGLDHSND------PNSVMYPYYRGPDNKTLSEDDIDGIQYL  152 (154)
T ss_dssp             HHHHHHHHHHHHTTBESSSS------TTSTTSSSCTSSSSTSTTHHHHHHHHHH
T ss_pred             hhhhhhhccccccCcCcCCC------cccceeeecccCCCCCCCHHHHHHHHHH
Confidence            34799999999999999753      4569999977532236666666655544


No 22 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=97.54  E-value=0.00068  Score=55.19  Aligned_cols=35  Identities=29%  Similarity=0.505  Sum_probs=25.6

Q ss_pred             HHHHHHHhhhhcCCCCCCCCCCCC----------CCCcccCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTECTCP----------SDRCIMAPSSS  250 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~c~C~----------~~~cIM~~~~~  250 (285)
                      -.|++|||||.||+.|....-.-.          ...-||.+...
T Consensus        95 ~~~~~HEiGHaLGL~H~~~~~~~~~~~~~~~~~~~~~SvM~y~~~  139 (165)
T cd04268          95 RNTAEHELGHALGLRHNFAASDRDDNVDLLAEKGDTSSVMDYAPS  139 (165)
T ss_pred             HHHHHHHHHHHhcccccCcCCccCCcchhhccCCCCcccCCCCcc
Confidence            479999999999999986521111          14689999764


No 23 
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=97.27  E-value=0.00026  Score=57.40  Aligned_cols=49  Identities=24%  Similarity=0.323  Sum_probs=35.1

Q ss_pred             HHHHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCCCCC--CCccCccCHHHHHhH
Q psy1606         215 VATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSSSVS--PTEWSSCSLEYLALS  268 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~~~~--~~~fS~CS~~~~~~~  268 (285)
                      +-.|++|||||.||+.|....     ..=||+|......  ....+...++-++.+
T Consensus       104 ~~~~~~HEiGHaLGL~H~~~~-----~~siM~p~~~~~~~~~~~l~~~D~~~i~~l  154 (156)
T cd04279         104 LQAIALHELGHALGLWHHSDR-----PEDAMYPSQGQGPDGNPTLSARDVATLKRL  154 (156)
T ss_pred             HHHHHHHHhhhhhcCCCCCCC-----ccceeeeecccCCcCcCCCCHHHHHHHHHH
Confidence            347999999999999998753     1368999876422  246777776666554


No 24 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=97.24  E-value=0.00066  Score=57.30  Aligned_cols=23  Identities=30%  Similarity=0.745  Sum_probs=19.5

Q ss_pred             chhHHHHHHHHHhhhhcCCCCCC
Q psy1606         211 VVGLVATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       211 ~~~~~a~~~AHElGH~lG~~HD~  233 (285)
                      .....+.+|+|||||.+|+.|.+
T Consensus       129 ~~~~~~hvi~HEiGH~IGfRHTD  151 (211)
T PF12388_consen  129 SVNVIEHVITHEIGHCIGFRHTD  151 (211)
T ss_pred             chhHHHHHHHHHhhhhccccccC
Confidence            34456889999999999999976


No 25 
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=97.21  E-value=0.00032  Score=56.92  Aligned_cols=46  Identities=26%  Similarity=0.385  Sum_probs=33.5

Q ss_pred             HHHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCCCC-CCCccCccCHHHHHh
Q psy1606         216 ATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSSSV-SPTEWSSCSLEYLAL  267 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~~~-~~~~fS~CS~~~~~~  267 (285)
                      -.|+.|||||.||+.|...      ..=||.|..... ....+|..-++-++.
T Consensus       108 ~~~~~HEiGHaLGL~H~~~------~~~vM~~~~~~~~~~~~l~~~D~~~~~~  154 (157)
T cd04278         108 FSVAAHEIGHALGLGHSSD------PDSIMYPYYQGPVPKFKLSQDDIRGIQA  154 (157)
T ss_pred             HHHHHHHhccccccCCCCC------CcCeecccccCCCcCCCCCHHHHHHHHH
Confidence            4699999999999999653      356999887642 245677666555554


No 26 
>PF05548 Peptidase_M11:  Gametolysin peptidase M11;  InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M11 (gametolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The type example is gametolysin from the unicellular biflagellated alga, Chlamydomonas reinhardtii Gametolysin is a zinc-containing metallo-protease, which is responsible for the degradation of the cell wall. Homologues of gametolysin have also been reported in the simple multicellular organism, Volvox [, ].
Probab=96.88  E-value=0.0013  Score=59.34  Aligned_cols=70  Identities=23%  Similarity=0.245  Sum_probs=38.7

Q ss_pred             CceeeeeeeecCCCceeccccCCCCcccccCceeecCCCchhHHHHHHHHHhhhhcCCCCCCC-CCCCCCCCcccCCC
Q psy1606         172 DNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDTT-ECTCPSDRCIMAPS  248 (285)
Q Consensus       172 D~a~llt~~~~~~~~~G~A~~g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG~~HD~~-~c~C~~~~cIM~~~  248 (285)
                      ...+++.-..+..+..|+|.+.|-+..-+   +....   .. -..++.|||||||||.|-+. +|.=++..|.|...
T Consensus       114 ~h~vyvlP~~~~C~w~Gla~v~G~~~~~~---~~~~~---~~-~~~~~~HElgHN~GL~Ha~~~~~eYgD~s~~MG~g  184 (314)
T PF05548_consen  114 THRVYVLPPGFACGWAGLATVPGSQSWLW---ISGYG---VQ-DWATIMHELGHNLGLWHAGRNGCEYGDPSDPMGCG  184 (314)
T ss_pred             ceEEEEcCCCCCCCceEEeecCCcceeee---ecCcc---cc-cHHHHHHHhhhhccccccCCCCccccCCCccCCCC
Confidence            33333333444356778888754433211   11110   01 12489999999999999864 33334567888633


No 27 
>PF02031 Peptidase_M7:  Streptomyces extracellular neutral proteinase (M7) family;  InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=96.67  E-value=0.0011  Score=51.15  Aligned_cols=31  Identities=32%  Similarity=0.591  Sum_probs=18.7

Q ss_pred             HHHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSS  250 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~  250 (285)
                      -.++||||||.||++....+ .|.   -+|+....
T Consensus        78 ~RIaaHE~GHiLGLPD~y~G-pCS---~LMSG~~a  108 (132)
T PF02031_consen   78 TRIAAHELGHILGLPDHYPG-PCS---ELMSGGSA  108 (132)
T ss_dssp             HHHHHHHHHHHHT----TTS--TT----GGGTTTT
T ss_pred             ceeeeehhccccCCCCCCCC-ccH---HhhcCCCC
Confidence            36999999999999876543 342   47877654


No 28 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=96.57  E-value=0.0011  Score=52.66  Aligned_cols=18  Identities=44%  Similarity=0.870  Sum_probs=16.2

Q ss_pred             HHHHHHhhhhcCCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~~  234 (285)
                      .+++|||||.||+.|...
T Consensus        88 ~~~~HEigHaLGl~H~~~  105 (140)
T smart00235       88 GVAAHELGHALGLYHEQS  105 (140)
T ss_pred             ccHHHHHHHHhcCCcCCC
Confidence            389999999999999864


No 29 
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=96.27  E-value=0.0016  Score=52.70  Aligned_cols=23  Identities=39%  Similarity=0.723  Sum_probs=15.0

Q ss_pred             HHHHHHHHhhhhcCCCCCCC-CCC
Q psy1606         215 VATTVAHEMGHNLGMEHDTT-ECT  237 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~-~c~  237 (285)
                      .+.|++||+||-|||.|--. +|.
T Consensus        69 ~g~TltHEvGH~LGL~HtF~~~C~   92 (154)
T PF05572_consen   69 FGKTLTHEVGHWLGLYHTFGGGCD   92 (154)
T ss_dssp             SSHHHHHHHHHHTT---TT---TS
T ss_pred             cccchhhhhhhhhcccccccCCCC
Confidence            35899999999999999753 454


No 30 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=96.08  E-value=0.0033  Score=52.38  Aligned_cols=35  Identities=31%  Similarity=0.476  Sum_probs=25.2

Q ss_pred             HHHHHHHhhhhcCCCCCCCC--CCC--------CCCCcccCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTE--CTC--------PSDRCIMAPSSS  250 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~--c~C--------~~~~cIM~~~~~  250 (285)
                      -.|+.|||||.|||.|....  ...        ...--||++...
T Consensus       114 ~~t~~HEiGHaLGL~H~~~~~~~~~~~~~~~~~~~~~SVMSY~~~  158 (186)
T cd04277         114 YQTIIHEIGHALGLEHPGDYNGGDPVPPTYALDSREYTVMSYNSG  158 (186)
T ss_pred             HHHHHHHHHHHhcCCCCCcCCCCCCCCccccccCcceEEEeecCC
Confidence            37999999999999998742  111        113579988755


No 31 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=95.78  E-value=0.0085  Score=50.49  Aligned_cols=20  Identities=40%  Similarity=0.773  Sum_probs=17.3

Q ss_pred             HHHHHHHHhhhhcCCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~  234 (285)
                      ...+++||+||.||+.|.-.
T Consensus       116 ~~~~~~he~gh~lGl~hn~~  135 (197)
T cd04276         116 LRYLLAHEVGHTLGLRHNFK  135 (197)
T ss_pred             HHHHHHHHHHHHhcCccccc
Confidence            45799999999999999754


No 32 
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=94.78  E-value=0.014  Score=49.30  Aligned_cols=18  Identities=44%  Similarity=0.804  Sum_probs=15.9

Q ss_pred             HHHHHHhhhhcCCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~~  234 (285)
                      .++.|||||.||+.|...
T Consensus        94 ~~i~HElgHaLG~~HEh~  111 (198)
T cd04327          94 RVVLHEFGHALGFIHEHQ  111 (198)
T ss_pred             HHHHHHHHHHhcCccccc
Confidence            589999999999999754


No 33 
>PF10462 Peptidase_M66:  Peptidase M66;  InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of metallopeptidases belonging to MEROPS peptidase family M66 (StcE peptidase, clan MA). The StcE peptidase is a virulence factor found in Shiga toxigenic Escherichia coli strains. StcE peptidase cleaves C1 esterase inhibitor []. The SwissProt proteins in this entry have been name "Dictomallein". ; GO: 0004222 metalloendopeptidase activity; PDB: 3UJZ_A.
Probab=94.39  E-value=0.022  Score=51.01  Aligned_cols=16  Identities=44%  Similarity=0.989  Sum_probs=13.1

Q ss_pred             HHHHHHHhhhhcCCCC
Q psy1606         216 ATTVAHEMGHNLGMEH  231 (285)
Q Consensus       216 a~~~AHElGH~lG~~H  231 (285)
                      ..+++||+||+||+.|
T Consensus       194 ~~~f~HE~GH~~GL~H  209 (305)
T PF10462_consen  194 GNEFSHELGHNFGLGH  209 (305)
T ss_dssp             HHHHHHHHHHTTT--S
T ss_pred             cceeehhhhhhcCCCC
Confidence            5799999999999999


No 34 
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=94.12  E-value=0.024  Score=47.17  Aligned_cols=17  Identities=35%  Similarity=0.649  Sum_probs=15.3

Q ss_pred             HHHHHHhhhhcCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~  233 (285)
                      .+++|||||.||+.|..
T Consensus        79 G~i~HEl~HaLG~~HEh   95 (182)
T cd04283          79 GIIQHELLHALGFYHEQ   95 (182)
T ss_pred             chHHHHHHHHhCCcccc
Confidence            48999999999999964


No 35 
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=93.75  E-value=0.03  Score=47.35  Aligned_cols=17  Identities=41%  Similarity=0.779  Sum_probs=15.1

Q ss_pred             HHHHHHhhhhcCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~  233 (285)
                      .+++|||||.||+.|..
T Consensus        89 Gti~HEl~HaLGf~HEh  105 (200)
T cd04281          89 GIVVHELGHVIGFWHEH  105 (200)
T ss_pred             chHHHHHHHHhcCcchh
Confidence            48999999999999954


No 36 
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=93.67  E-value=0.029  Score=46.56  Aligned_cols=17  Identities=41%  Similarity=0.733  Sum_probs=15.4

Q ss_pred             HHHHHHhhhhcCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~  233 (285)
                      .++.|||||.||+.|..
T Consensus        76 g~v~HE~~HalG~~HEh   92 (180)
T cd04280          76 GTIVHELMHALGFYHEQ   92 (180)
T ss_pred             chhHHHHHHHhcCcchh
Confidence            58999999999999964


No 37 
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=93.35  E-value=0.033  Score=46.71  Aligned_cols=18  Identities=44%  Similarity=0.822  Sum_probs=13.8

Q ss_pred             HHHHHHHhhhhcCCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~  233 (285)
                      ..+++|||||.||+.|..
T Consensus        80 ~~~i~HEl~HaLG~~HEh   97 (191)
T PF01400_consen   80 VGTILHELGHALGFWHEH   97 (191)
T ss_dssp             HHHHHHHHHHHHTB--GG
T ss_pred             ccchHHHHHHHHhhhhhh
Confidence            358999999999999954


No 38 
>KOG1565|consensus
Probab=93.27  E-value=0.06  Score=51.34  Aligned_cols=30  Identities=37%  Similarity=0.605  Sum_probs=24.2

Q ss_pred             HHHHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSS  250 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~  250 (285)
                      +..|+|||+||.||+.|-..      .+=||+|...
T Consensus       211 l~~Va~HEiGH~LGL~HS~~------~~aiM~P~y~  240 (469)
T KOG1565|consen  211 LFLVAAHEIGHALGLGHSSD------PDAIMYPFYQ  240 (469)
T ss_pred             hHHHhhhhcccccccCCCCC------cccccccccc
Confidence            45799999999999999633      4568888876


No 39 
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=92.62  E-value=0.056  Score=46.65  Aligned_cols=17  Identities=47%  Similarity=0.730  Sum_probs=15.2

Q ss_pred             HHHHHHhhhhcCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~  233 (285)
                      .+++|||||.||+.|..
T Consensus       122 Gti~HEl~HalGf~HEq  138 (230)
T cd04282         122 ATVEHEFLHALGFYHEQ  138 (230)
T ss_pred             chHHHHHHHHhCCcccc
Confidence            48999999999999954


No 40 
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain. This model describes a metalloproteinase domain, with a characteristic HExxH motif. Examples of this domain are found in proteins in the family of immune inhibitor A, which cleaves antibacterial peptides, and in other, only distantly related proteases. This model is built to be broader and more inclusive than Pfam model pfam05547.
Probab=91.91  E-value=0.044  Score=49.00  Aligned_cols=33  Identities=24%  Similarity=0.405  Sum_probs=22.6

Q ss_pred             HHHHHHHhhhhcCCCCCCCC-CCCC----CCCcccCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTE-CTCP----SDRCIMAPS  248 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~-c~C~----~~~cIM~~~  248 (285)
                      ..|+|||+||.||+++=-.. ....    ..-+||+..
T Consensus       166 igv~~HE~gH~lGLPDlY~~~~~~~~~~vG~w~lM~~G  203 (286)
T TIGR03296       166 VGVIAHELGHDLGLPDLYDTSYDGGGEPVGYWSLMSSG  203 (286)
T ss_pred             eeeeehhhhcccCCCccccCcCCCCCCCccccccccCC
Confidence            36999999999999884321 1111    245999883


No 41 
>smart00608 ACR ADAM Cysteine-Rich Domain.
Probab=89.63  E-value=0.43  Score=37.77  Aligned_cols=60  Identities=30%  Similarity=0.455  Sum_probs=41.5

Q ss_pred             CcccccccccccCCcceEEEeecccccCCceEEeccCccccccccccCCCCCCCCCCCCCCCcccc
Q psy1606           1 MLHCQHLSEKLEYGIETVAILSHSFLNPGGFIIPCRSAIVDLGLNQVDPGLSPDGARCGDGKTKRD   66 (285)
Q Consensus         1 ~~~c~y~g~~~~~~~~~v~~~~~~~~~~~~~i~p~~~~~~~~~l~~~~~~~~~~~~~Cg~~~~~~~   66 (285)
                      .|+|.+..+.+..+.....+.+..      .-..|+++..+......|+++.+++++||.+|...+
T Consensus        72 kL~C~~~~~~p~~~~~~~~~~~~~------~~~~C~~~~~~~~~~~~d~g~V~dGT~CG~~kvC~n  131 (137)
T smart00608       72 KLQCTNVSSLPLLGEHATVIYSNI------GGLVCWSLDYHLGSDSTDLGMVKDGTKCGPGKVCIN  131 (137)
T ss_pred             eEEecCCCccccccCcceEEEecc------CCCEEEEeeECCCCCCCCccccCCCCCcCCCCccCC
Confidence            478888888877666555544432      123577665555555568899999999999987654


No 42 
>COG3824 Predicted Zn-dependent protease [General function prediction only]
Probab=88.90  E-value=0.19  Score=38.35  Aligned_cols=20  Identities=35%  Similarity=0.762  Sum_probs=17.2

Q ss_pred             HHHHHHHHHhhhhcCCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD~  233 (285)
                      .++.++-|||||-||+.-|.
T Consensus       108 ~vthvliHEIgHhFGLsDdd  127 (136)
T COG3824         108 QVTHVLIHEIGHHFGLSDDD  127 (136)
T ss_pred             HhhhhhhhhhhhhcCCChhH
Confidence            35789999999999998775


No 43 
>KOG3714|consensus
Probab=88.81  E-value=0.16  Score=47.85  Aligned_cols=17  Identities=41%  Similarity=0.696  Sum_probs=15.2

Q ss_pred             HHHHHHhhhhcCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~  233 (285)
                      .|++|||+|.||..|..
T Consensus       161 G~i~HEl~HaLGf~Heh  177 (411)
T KOG3714|consen  161 GTIVHELMHALGFWHEH  177 (411)
T ss_pred             chhHHHHHHHhhhhhcc
Confidence            48999999999999954


No 44 
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=88.50  E-value=0.24  Score=41.80  Aligned_cols=16  Identities=31%  Similarity=0.447  Sum_probs=13.9

Q ss_pred             hhHHHHHHHHHhhhhc
Q psy1606         212 VGLVATTVAHEMGHNL  227 (285)
Q Consensus       212 ~~~~a~~~AHElGH~l  227 (285)
                      ++.++.++||||+|.|
T Consensus        33 yg~lG~ilahel~haf   48 (206)
T PF01431_consen   33 YGGLGFILAHELMHAF   48 (206)
T ss_dssp             HHTHHHHHHHHHHHCT
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5567899999999988


No 45 
>PF12044 Metallopep:  Putative peptidase family;  InterPro: IPR021917  This family of proteins is functionally uncharacterised. However, it does contain an HEXXH motif characteristic of metallopeptidases. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 625 to 773 amino acids in length. 
Probab=88.47  E-value=0.27  Score=46.18  Aligned_cols=18  Identities=33%  Similarity=0.637  Sum_probs=15.6

Q ss_pred             HHHHHhhhhcCCCCCCCC
Q psy1606         218 TVAHEMGHNLGMEHDTTE  235 (285)
Q Consensus       218 ~~AHElGH~lG~~HD~~~  235 (285)
                      .+-|||||.||++|-..+
T Consensus       319 A~lHEiGH~fg~pH~~~G  336 (423)
T PF12044_consen  319 AFLHEIGHLFGCPHQEDG  336 (423)
T ss_pred             HHHHHHHHhcCCCCCCCC
Confidence            588999999999997753


No 46 
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=87.30  E-value=0.4  Score=42.30  Aligned_cols=20  Identities=35%  Similarity=0.536  Sum_probs=12.7

Q ss_pred             HHHHHHHHhhhhcCCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~  234 (285)
                      ...++.||+||.||--=|+.
T Consensus       216 ~~~v~vHE~GHsf~~LaDEY  235 (264)
T PF09471_consen  216 FKQVVVHEFGHSFGGLADEY  235 (264)
T ss_dssp             HHHHHHHHHHHHTT------
T ss_pred             ccceeeeecccccccccccc
Confidence            46899999999999888874


No 47 
>KOG3624|consensus
Probab=84.17  E-value=0.97  Score=45.49  Aligned_cols=17  Identities=24%  Similarity=0.464  Sum_probs=14.6

Q ss_pred             chhHHHHHHHHHhhhhc
Q psy1606         211 VVGLVATTVAHEMGHNL  227 (285)
Q Consensus       211 ~~~~~a~~~AHElGH~l  227 (285)
                      +++.++.+|||||+|.|
T Consensus       514 nyg~iG~vigHEl~H~F  530 (687)
T KOG3624|consen  514 NYGGIGFVIGHELTHGF  530 (687)
T ss_pred             hhHHHHHHHHHHHhhcc
Confidence            45667899999999988


No 48 
>PF06262 DUF1025:  Possibl zinc metallo-peptidase;  InterPro: IPR010428 This is a family of bacterial protein with undetermined function.; PDB: 3E11_A.
Probab=84.16  E-value=0.76  Score=34.09  Aligned_cols=19  Identities=32%  Similarity=0.791  Sum_probs=14.4

Q ss_pred             HHHHHHHHHhhhhcCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHD  232 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD  232 (285)
                      .+..|+-||+||.||+.-|
T Consensus        72 ~I~~tlvhEiah~fG~~~e   90 (97)
T PF06262_consen   72 LIRDTLVHEIAHHFGISDE   90 (97)
T ss_dssp             HHHHHHHHHHHHHTT--HH
T ss_pred             HHHHHHHHHHHHHcCCCHH
Confidence            3578999999999998654


No 49 
>PF12725 DUF3810:  Protein of unknown function (DUF3810);  InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised. Proteins in this family are typically between 333 and 377 amino acids in length and contain a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterised family of peptidase enzymes.
Probab=83.65  E-value=0.56  Score=42.59  Aligned_cols=19  Identities=32%  Similarity=0.707  Sum_probs=16.4

Q ss_pred             HHHHHHHHhhhhcCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~  233 (285)
                      ...|+||||+|.+|....+
T Consensus       196 ~P~T~~HElAHq~G~a~E~  214 (318)
T PF12725_consen  196 LPFTICHELAHQLGFASED  214 (318)
T ss_pred             ccHHHHHHHHHHhCCCCHH
Confidence            4689999999999987755


No 50 
>PF11350 DUF3152:  Protein of unknown function (DUF3152);  InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function. Some are annotated as membrane proteins, however this cannot be confirmed.
Probab=83.64  E-value=0.91  Score=38.10  Aligned_cols=42  Identities=31%  Similarity=0.612  Sum_probs=26.4

Q ss_pred             HHHHHHHHhhhhcCCCCCCCCCCCCC---CCcccCCCCCCCCCCccCccCHHHH
Q psy1606         215 VATTVAHEMGHNLGMEHDTTECTCPS---DRCIMAPSSSSVSPTEWSSCSLEYL  265 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~~c~C~~---~~cIM~~~~~~~~~~~fS~CS~~~~  265 (285)
                      -..+|=||+||-||-.|.    .|+.   .-=||-..     .+..++|-+..|
T Consensus       139 RqYvINHEVGH~LGh~H~----~Cpg~G~~APVMmQQ-----T~gL~g~~~~~~  183 (203)
T PF11350_consen  139 RQYVINHEVGHALGHGHE----PCPGPGRPAPVMMQQ-----TLGLDGCELAKL  183 (203)
T ss_pred             HHHhhhhhhhhhcccCCC----cCCCCCCcCCcchhh-----hcccCCcccccc
Confidence            368999999999997774    3554   23566554     233445544444


No 51 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=83.54  E-value=1.1  Score=33.59  Aligned_cols=18  Identities=39%  Similarity=0.368  Sum_probs=13.5

Q ss_pred             CchhHHHHHHHHHhhhhc
Q psy1606         210 NVVGLVATTVAHEMGHNL  227 (285)
Q Consensus       210 ~~~~~~a~~~AHElGH~l  227 (285)
                      .+...-..++||||||.+
T Consensus        37 ~~~~~~~f~laHELgH~~   54 (122)
T PF06114_consen   37 LSPERQRFTLAHELGHIL   54 (122)
T ss_dssp             S-HHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHH
Confidence            334455689999999987


No 52 
>KOG4525|consensus
Probab=82.89  E-value=0.75  Score=42.86  Aligned_cols=19  Identities=42%  Similarity=0.760  Sum_probs=16.2

Q ss_pred             HHHHHHhhhhcCCCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDTTE  235 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~~~  235 (285)
                      -.|-|||||.||++|...+
T Consensus       303 GA~~HElGH~lgcpHq~~G  321 (614)
T KOG4525|consen  303 GAVCHELGHCLGCPHQSEG  321 (614)
T ss_pred             HHHHHHhhhccCCCCCCCc
Confidence            4688999999999998753


No 53 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=81.50  E-value=0.69  Score=39.44  Aligned_cols=13  Identities=54%  Similarity=0.792  Sum_probs=11.4

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      -=+|+||||||.|
T Consensus        72 ~rFtlAHELGH~l   84 (213)
T COG2856          72 KRFTLAHELGHAL   84 (213)
T ss_pred             HHHHHHHHHhHHH
Confidence            3479999999998


No 54 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=80.27  E-value=1.2  Score=33.60  Aligned_cols=15  Identities=27%  Similarity=0.530  Sum_probs=12.3

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      ..+..+++||++|.+
T Consensus        23 ~~~~~~l~HE~~H~~   37 (128)
T PF13485_consen   23 DWLDRVLAHELAHQW   37 (128)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344589999999998


No 55 
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=79.02  E-value=1.1  Score=42.41  Aligned_cols=17  Identities=35%  Similarity=0.483  Sum_probs=14.2

Q ss_pred             hhHHHHHHHHHhhhhcC
Q psy1606         212 VGLVATTVAHEMGHNLG  228 (285)
Q Consensus       212 ~~~~a~~~AHElGH~lG  228 (285)
                      ..-+|.++||||||..|
T Consensus       127 esElagViAHEigHv~q  143 (484)
T COG4783         127 ESELAGVIAHEIGHVAQ  143 (484)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            34568999999999987


No 56 
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=78.53  E-value=2.2  Score=35.76  Aligned_cols=22  Identities=23%  Similarity=0.306  Sum_probs=18.3

Q ss_pred             hHHHHHHHHHhhhhcCCCCCCC
Q psy1606         213 GLVATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG~~HD~~  234 (285)
                      ..+..+++|||.|..-++|...
T Consensus       162 ~~idYVvvHEL~Hl~~~nHs~~  183 (205)
T PF01863_consen  162 EVIDYVVVHELCHLRHPNHSKR  183 (205)
T ss_pred             cHHHHHHHHHHHHhccCCCCHH
Confidence            3456899999999999999753


No 57 
>COG3590 PepO Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]
Probab=78.52  E-value=0.68  Score=44.66  Aligned_cols=25  Identities=28%  Similarity=0.582  Sum_probs=20.5

Q ss_pred             chhHHHHHHHHHhhhhc---CCCCCCCC
Q psy1606         211 VVGLVATTVAHEMGHNL---GMEHDTTE  235 (285)
Q Consensus       211 ~~~~~a~~~AHElGH~l---G~~HD~~~  235 (285)
                      ++++++.+|+|||||-|   |...|+.+
T Consensus       483 NYGgIGaVIgHEI~HgFDdqGakfD~~G  510 (654)
T COG3590         483 NYGGIGAVIGHEIGHGFDDQGAKFDGDG  510 (654)
T ss_pred             cccCccceehhhhcccccCCccccCCCC
Confidence            56777889999999999   77777754


No 58 
>PF05547 Peptidase_M6:  Immune inhibitor A peptidase M6;  InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M6 (immune inhibitor A family, clan MA(M)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.  InhA of Bacillus thuringiensis (an entomopathogenic bacterium) specifically cleaves antibacterial peptides produced by insect hosts []. B. thuringiensis is highly resistant to the insect immune system due to its production of two factors, inhibitor A (InhA or InA) and inhibitor B (InhB or InB), which selectively block the humoral defence system developed by insects against Escherichia coli and Bacillus cereus []. B. thuringiensis is especially resistant to cecropins and attacins, which are the main classes of inducible antibacterial peptides in various lepidopterans and dipterans [], []. InhA has been shown to specifically hydrolyze cecropins and attacins in the immune hemolymph of Hyalophora cecropia (Cecropia moth) in vitro []. However, it has been suggested that the role of InhA in resistance to the humoral defence system is not consistent with the time course of InhA production []. B. thuringiensis has two proteins belonging to this group (InhA and InhA2), and it has been shown that InhA2 has a vital role in virulence when the host is infected via the oral route []. The B. cereus member has been found as an exosporium component from endospores []. B. thuringiensis InhA is induced at the onset of sporulation and is regulated by Spo0A and AbrB []. Vibrio cholerae PrtV is thought to be encoded in the pathogenicity island []. However, PrtV mutants did not exhibit a reduced virulence phenotype, and thus PrtV is not an indispensable virulence factor []. Annotation note: due to the presence of PKD repeats in some of the members of this group (e.g., V. cholerae VCA0223), spurious similarity hits may appear (involving unrelated proteins), which may lead to the erroneous transfer of functional annotations and protein names. Also, please note that related Bacillus subtilis Bacillopeptidase F (Bpr or Bpf) contains two different protease domains: N-terminal IPR000209 from INTERPRO (peptidase S8, subtilase, a subtilisin-like serine protease) and this C-terminal domain (peptidase M6), which may also complicate annotation.; GO: 0008233 peptidase activity, 0006508 proteolysis
Probab=75.40  E-value=0.52  Score=46.72  Aligned_cols=34  Identities=26%  Similarity=0.344  Sum_probs=22.3

Q ss_pred             HHHHHHHhhhhcCCCCCCCC--CCC--C-CCCcccCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTE--CTC--P-SDRCIMAPSS  249 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~--c~C--~-~~~cIM~~~~  249 (285)
                      .-++|||+||.||++---..  -.=  + ..-+||+...
T Consensus       222 iGVfaHEfGH~LGLPDlYDT~~~g~~~~vg~WsLMs~GS  260 (645)
T PF05547_consen  222 IGVFAHEFGHDLGLPDLYDTDYSGGGNGVGFWSLMSSGS  260 (645)
T ss_pred             eEEEEeeccccCCCCCcccCCCCCCCCCcccceecCCCC
Confidence            35899999999999863321  000  1 1358998754


No 59 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=72.86  E-value=2.1  Score=36.13  Aligned_cols=16  Identities=38%  Similarity=0.522  Sum_probs=13.2

Q ss_pred             hHHHHHHHHHhhhhcC
Q psy1606         213 GLVATTVAHEMGHNLG  228 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG  228 (285)
                      .-++.++|||+||.-+
T Consensus        87 ~el~aVlaHElgH~~~  102 (226)
T PF01435_consen   87 DELAAVLAHELGHIKH  102 (226)
T ss_dssp             HHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHc
Confidence            3467899999999984


No 60 
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=67.35  E-value=3.5  Score=34.79  Aligned_cols=21  Identities=38%  Similarity=0.632  Sum_probs=17.0

Q ss_pred             hHHHHHHHHHhhhhcCCC-CCC
Q psy1606         213 GLVATTVAHEMGHNLGME-HDT  233 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG~~-HD~  233 (285)
                      ..+-.|+-||+||.||+. |..
T Consensus       185 e~L~~tarhElGhaLgi~ghsd  206 (236)
T COG5549         185 ENLNPTARHELGHALGIWGHSD  206 (236)
T ss_pred             hhhhHHHHHhhcchheeccccc
Confidence            345579999999999998 754


No 61 
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family. The M3 family of metallopeptidases contains several distinct clades. Oligoendopeptidase F as characterized in Lactococcus, the functionally equivalent oligoendopeptidase B of group B Streptococcus, and closely related sequences are described by TIGR00181. The present family is quite similar but forms a distinct clade, and a number of species have one member of each. A greater sequence difference separates members of TIGR02289, probable oligoendopeptidases of the M3 family that probably should not be designated PepF.
Probab=66.33  E-value=5.2  Score=39.50  Aligned_cols=12  Identities=50%  Similarity=0.916  Sum_probs=11.0

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..|+|||+||.+
T Consensus       376 v~TL~HE~GHa~  387 (587)
T TIGR02290       376 VSTLAHELGHAY  387 (587)
T ss_pred             HHHHHHHhhHHH
Confidence            589999999998


No 62 
>PRK03001 M48 family peptidase; Provisional
Probab=65.94  E-value=3.5  Score=36.72  Aligned_cols=15  Identities=27%  Similarity=0.361  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      .-++.++||||||.-
T Consensus       122 ~El~aVlAHElgHi~  136 (283)
T PRK03001        122 REIRGVMAHELAHVK  136 (283)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            345789999999986


No 63 
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=65.79  E-value=5.5  Score=39.02  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=11.0

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..|+|||+||.+
T Consensus       338 v~TL~HElGHa~  349 (549)
T TIGR02289       338 IDVLTHEAGHAF  349 (549)
T ss_pred             HHHHHHHhhHHH
Confidence            589999999998


No 64 
>PRK03982 heat shock protein HtpX; Provisional
Probab=65.12  E-value=3.7  Score=36.66  Aligned_cols=15  Identities=27%  Similarity=0.355  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      .-.+.++|||+||.-
T Consensus       123 ~El~AVlAHElgHi~  137 (288)
T PRK03982        123 DELEGVIAHELTHIK  137 (288)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345789999999986


No 65 
>PRK01345 heat shock protein HtpX; Provisional
Probab=63.74  E-value=4.1  Score=36.96  Aligned_cols=15  Identities=40%  Similarity=0.439  Sum_probs=12.6

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      .-++.++||||||.-
T Consensus       122 dEL~aVlAHElgHi~  136 (317)
T PRK01345        122 EEVAGVMAHELAHVK  136 (317)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            346789999999998


No 66 
>PRK03072 heat shock protein HtpX; Provisional
Probab=63.23  E-value=4.2  Score=36.35  Aligned_cols=16  Identities=19%  Similarity=0.326  Sum_probs=12.7

Q ss_pred             hHHHHHHHHHhhhhcC
Q psy1606         213 GLVATTVAHEMGHNLG  228 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG  228 (285)
                      .-+..++|||+||.-.
T Consensus       125 ~El~aVlAHElgHi~~  140 (288)
T PRK03072        125 RELRGVLGHELSHVYN  140 (288)
T ss_pred             HHHHHHHHHHHHHHhc
Confidence            3457899999999863


No 67 
>PF04228 Zn_peptidase:  Putative neutral zinc metallopeptidase;  InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=61.71  E-value=5.1  Score=35.94  Aligned_cols=13  Identities=46%  Similarity=0.647  Sum_probs=10.6

Q ss_pred             HHHHHHHHHhhhh
Q psy1606         214 LVATTVAHEMGHN  226 (285)
Q Consensus       214 ~~a~~~AHElGH~  226 (285)
                      ..+.+||||.||-
T Consensus       169 a~ayVlAHEyGHH  181 (292)
T PF04228_consen  169 AQAYVLAHEYGHH  181 (292)
T ss_pred             HHHHHHHHHHHHH
Confidence            3567999999994


No 68 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=61.53  E-value=4.8  Score=35.75  Aligned_cols=14  Identities=36%  Similarity=0.570  Sum_probs=12.0

Q ss_pred             HHHHHHHHHhhhhc
Q psy1606         214 LVATTVAHEMGHNL  227 (285)
Q Consensus       214 ~~a~~~AHElGH~l  227 (285)
                      -+..++|||+||..
T Consensus       156 El~aVlaHElgHi~  169 (302)
T COG0501         156 ELEAVLAHELGHIK  169 (302)
T ss_pred             HHHHHHHHHHHHHh
Confidence            45789999999986


No 69 
>PF01433 Peptidase_M1:  Peptidase family M1 This is family M1 in the peptidase classification.;  InterPro: IPR014782 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M1 (clan MA(E)), the type example being aminopeptidase N from Homo sapiens (Human). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.  Membrane alanine aminopeptidase (3.4.11.2 from EC) is part of the HEXXH+E group; it consists entirely of aminopeptidases, spread across a wide variety of species []. Functional studies show that CD13/APN catalyzes the removal of single amino acids from the amino terminus of small peptides and probably plays a role in their final digestion; one family member (leukotriene-A4 hydrolase) is known to hydrolyse the epoxide leukotriene-A4 to form an inflammatory mediator []. This hydrolase has been shown to have aminopeptidase activity [], and the zinc ligands of the M1 family were identified by site-directed mutagenesis on this enzyme [] CD13 participates in trimming peptides bound to MHC class II molecules [] and cleaves MIP-1 chemokine, which alters target cell specificity from basophils to eosinophils []. CD13 acts as a receptor for specific strains of RNA viruses (coronaviruses) which cause a relatively large percentage of upper respiratory trace infections. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 2XQ0_A 2XPY_A 2XPZ_A 3SE6_B 3EBH_A 3EBG_A 3T8V_A 3Q44_A 3Q43_A 3EBI_A ....
Probab=60.35  E-value=17  Score=33.50  Aligned_cols=14  Identities=36%  Similarity=0.650  Sum_probs=11.8

Q ss_pred             HHHHHHHHHhhhhc
Q psy1606         214 LVATTVAHEMGHNL  227 (285)
Q Consensus       214 ~~a~~~AHElGH~l  227 (285)
                      ..+.++||||+|..
T Consensus       294 ~~~~~iahElahqW  307 (390)
T PF01433_consen  294 EIASLIAHELAHQW  307 (390)
T ss_dssp             HHHHHHHHHHHTTT
T ss_pred             hhHHHHHHHHHHHH
Confidence            45789999999995


No 70 
>PRK05457 heat shock protein HtpX; Provisional
Probab=59.86  E-value=5.3  Score=35.67  Aligned_cols=15  Identities=33%  Similarity=0.446  Sum_probs=12.2

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      .-...++|||+||.-
T Consensus       132 ~El~aVlAHElgHi~  146 (284)
T PRK05457        132 DEVEAVLAHEISHIA  146 (284)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345789999999975


No 71 
>PRK04897 heat shock protein HtpX; Provisional
Probab=59.73  E-value=5.3  Score=35.90  Aligned_cols=15  Identities=20%  Similarity=0.317  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      .-...++|||+||.-
T Consensus       135 ~El~aVlAHElgHi~  149 (298)
T PRK04897        135 EELEGVIGHEISHIR  149 (298)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            345689999999986


No 72 
>COG1164 Oligoendopeptidase F [Amino acid transport and metabolism]
Probab=59.24  E-value=9.1  Score=37.97  Aligned_cols=12  Identities=50%  Similarity=0.897  Sum_probs=11.0

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..|+|||+||.+
T Consensus       381 V~TLaHElGHs~  392 (598)
T COG1164         381 VFTLAHELGHSV  392 (598)
T ss_pred             HHHHHHHccHHH
Confidence            489999999998


No 73 
>TIGR00181 pepF oligoendopeptidase F. This family represents the oligoendopeptidase F clade of the family of larger M3 or thimet (for thiol-dependent metallopeptidase) oligopeptidase family. Lactococcus lactis PepF hydrolyzed peptides of 7 and 17 amino acids with fairly broad specificity. The homolog of lactococcal PepF in group B Streptococcus was named PepB (PubMed:8757883), with the name difference reflecting a difference in species of origin rather activity; substrate profiles were quite similar. Differences in substrate specificity should be expected in other species. The gene is duplicated in Lactococcus lactis on the plasmid that bears it. A shortened second copy is found in Bacillus subtilis.
Probab=58.68  E-value=4.5  Score=39.89  Aligned_cols=13  Identities=46%  Similarity=0.828  Sum_probs=11.4

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      -..|+|||+||.+
T Consensus       378 dv~TLaHElGHa~  390 (591)
T TIGR00181       378 SVFTLAHELGHSM  390 (591)
T ss_pred             hHHHHHHHhhhHH
Confidence            3589999999997


No 74 
>PF01447 Peptidase_M4:  Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=57.88  E-value=5.3  Score=32.11  Aligned_cols=12  Identities=42%  Similarity=0.670  Sum_probs=10.0

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..++||||+|-+
T Consensus       136 lDVvaHEltHGV  147 (150)
T PF01447_consen  136 LDVVAHELTHGV  147 (150)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             cceeeecccccc
Confidence            479999999953


No 75 
>KOG2719|consensus
Probab=57.45  E-value=5.6  Score=37.35  Aligned_cols=39  Identities=23%  Similarity=0.148  Sum_probs=22.6

Q ss_pred             ceeccccCCCCcccccCceeecCC------CchhHHHHHHHHHhhhh
Q psy1606         186 VVGKALKGPICTYEFSGGVNVDHK------NVVGLVATTVAHEMGHN  226 (285)
Q Consensus       186 ~~G~A~~g~~C~~~~~~~v~~~~~------~~~~~~a~~~AHElGH~  226 (285)
                      .---||.-|.|...+  -+..|.=      -+-..++.++|||+||-
T Consensus       247 ~hsNAyfyG~~~~KR--IvIyDtLl~~~~~~~~eel~AVl~HELGHW  291 (428)
T KOG2719|consen  247 SHSNAYFYGLCKNKR--IVIYDTLLLEEEHLNNEELVAVLAHELGHW  291 (428)
T ss_pred             CCCCeeeeeccccce--EEEehhhhhhhhccccHHHHHHHHHHhhHH
Confidence            345678878887542  2222210      11233567999999995


No 76 
>PRK01265 heat shock protein HtpX; Provisional
Probab=56.82  E-value=6.4  Score=35.87  Aligned_cols=14  Identities=29%  Similarity=0.501  Sum_probs=11.4

Q ss_pred             HHHHHHHHHhhhhc
Q psy1606         214 LVATTVAHEMGHNL  227 (285)
Q Consensus       214 ~~a~~~AHElGH~l  227 (285)
                      -+..++||||||.-
T Consensus       139 El~aVlAHElgHik  152 (324)
T PRK01265        139 EIKAVAGHELGHLK  152 (324)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35689999999973


No 77 
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=56.81  E-value=7.9  Score=33.16  Aligned_cols=12  Identities=42%  Similarity=0.819  Sum_probs=10.5

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..++|||.||-+
T Consensus        90 vaVAAHEvGHAi  101 (222)
T PF04298_consen   90 VAVAAHEVGHAI  101 (222)
T ss_pred             HHHHHHHHhHHH
Confidence            469999999987


No 78 
>PRK02870 heat shock protein HtpX; Provisional
Probab=56.64  E-value=6.4  Score=36.05  Aligned_cols=14  Identities=29%  Similarity=0.465  Sum_probs=11.7

Q ss_pred             hHHHHHHHHHhhhh
Q psy1606         213 GLVATTVAHEMGHN  226 (285)
Q Consensus       213 ~~~a~~~AHElGH~  226 (285)
                      .-++.++||||||.
T Consensus       171 dEL~aVlAHELgHi  184 (336)
T PRK02870        171 DELQAVMAHELSHI  184 (336)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34578999999998


No 79 
>PRK02391 heat shock protein HtpX; Provisional
Probab=56.59  E-value=6.5  Score=35.34  Aligned_cols=15  Identities=27%  Similarity=0.410  Sum_probs=11.9

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      .-...++|||+||.-
T Consensus       131 ~El~aVlaHElgHi~  145 (296)
T PRK02391        131 DELEAVLAHELSHVK  145 (296)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345689999999965


No 80 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=55.18  E-value=5.8  Score=28.14  Aligned_cols=11  Identities=36%  Similarity=0.667  Sum_probs=9.8

Q ss_pred             HHHHHHhhhhc
Q psy1606         217 TTVAHEMGHNL  227 (285)
Q Consensus       217 ~~~AHElGH~l  227 (285)
                      .++||||.|.+
T Consensus        63 ~llaHEl~Hv~   73 (79)
T PF13699_consen   63 ALLAHELAHVV   73 (79)
T ss_pred             hhHhHHHHHHH
Confidence            68999999985


No 81 
>COG1451 Predicted metal-dependent hydrolase [General function prediction only]
Probab=54.45  E-value=9.1  Score=32.90  Aligned_cols=20  Identities=25%  Similarity=0.423  Sum_probs=17.0

Q ss_pred             HHHHHHHHHhhhhcCCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD~  233 (285)
                      ..-.+++|||+|+.=++|-.
T Consensus       174 ~i~YVvvHELaHLke~nHs~  193 (223)
T COG1451         174 VIDYVVVHELAHLKEKNHSK  193 (223)
T ss_pred             HHHHHHHHHHHHHhhhhccH
Confidence            34689999999999999964


No 82 
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain. Present in this group is the RNA-binding post-transcriptional regulator Cip2 (Csx1-interacting protein 2) involved in counteracting Csx1 function. Csx1 plays a central role in controlling gene expression during oxidative stress. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=53.99  E-value=8  Score=25.92  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=15.6

Q ss_pred             HHHHHHhhhhcCCCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~~  234 (285)
                      ..+.|.++|.||+.|-..
T Consensus        31 Rriih~la~~lGL~~~s~   48 (60)
T cd02639          31 RRIVHLLASRLGLNHVSD   48 (60)
T ss_pred             HHHHHHHHHHcCCceEEe
Confidence            678999999999999654


No 83 
>PF08325 WLM:  WLM domain;  InterPro: IPR013536 The WLM (WSS1-like metalloprotease) domain is a globular domain related to the zincin-like superfamily of Zn-dependent peptidase. Since the WLM domain contains all known active site residues of zincins, it is predicted to be a catalytically active peptidase domain. The WLM domain is a eukaryotic domain represented in plants, fungi, Plasmodium, and kinetoplastids. By contrast, it is absent in animals, Cryptosporidium, and Microsporidia, suggesting that it has been lost on multiple occasions during the evolution of eukaryotes. The WLM domain is found either in stand-alone form or in association with other domains such as the RanBP2 zinc finger , the ubiquitin domain, or the PUB/PUG domain. This domain could function as a specific de-SUMOylating domain of distinct protein complexes in the nucleus and the cytoplasm []. It has been suggested to form a segregated alpha/beta structure with eight helices and five strands. Proteins containign this domain include yeast WSS1 (a weak suppressor of the Ub-related protein SMT3), and various putative metalloproteases from plant and fungal species.
Probab=53.02  E-value=11  Score=31.38  Aligned_cols=23  Identities=30%  Similarity=0.442  Sum_probs=19.2

Q ss_pred             hhHHHHHHHHHhhhhcCCCCCCC
Q psy1606         212 VGLVATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       212 ~~~~a~~~AHElGH~lG~~HD~~  234 (285)
                      +..+-.||-|||.|+.=.+||..
T Consensus        79 ~~~i~~t~lHELaH~~~~~H~~~  101 (186)
T PF08325_consen   79 YETILGTMLHELAHNVHGPHDDK  101 (186)
T ss_pred             HHHHHHHHHHHHHhcccCCccHH
Confidence            34456899999999999999974


No 84 
>PF01457 Peptidase_M8:  Leishmanolysin This Prosite motif covers only the active site. This is family M8 in the peptidase classification. ;  InterPro: IPR001577 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M8 (leishmanolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.   Leishmanolysin is an enzyme found in the eukaryotes including Leishmania and related parasitic protozoa []. The endopeptidase is the most abundant protein on the cell surface during the promastigote stage of the parasite, and is attached to the membrane by a glycosylphosphatidylinositol anchor []. In the amastigote form, the parasite lives in lysosomes of host macrophages, producing a form of the protease that has an acidic pH optimum []. This differs from most other metalloproteases and may be an adaptation to the environment in which the organism survives [].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0007155 cell adhesion, 0016020 membrane; PDB: 1LML_A.
Probab=52.51  E-value=7.8  Score=37.74  Aligned_cols=59  Identities=24%  Similarity=0.215  Sum_probs=26.0

Q ss_pred             CCCceeeeeeeecCCCceeccccCCCCccc----ccCceeecCCC-----chhHHHHHHHHHhhhhcCCCC
Q psy1606         170 PNDNAQLLTGMTFSDGVVGKALKGPICTYE----FSGGVNVDHKN-----VVGLVATTVAHEMGHNLGMEH  231 (285)
Q Consensus       170 ~~D~a~llt~~~~~~~~~G~A~~g~~C~~~----~~~~v~~~~~~-----~~~~~a~~~AHElGH~lG~~H  231 (285)
                      ..|+.+.++.++...++  +||- +.|...    --.|+......     .......+++|||+|.||..-
T Consensus       159 ~~D~vlyV~~~~~~~~~--~A~A-~~C~~~~~~RP~~G~in~~p~~i~~~~~~~~~~~~~HEi~HaLGFs~  226 (521)
T PF01457_consen  159 NADFVLYVTARPSSSST--LAWA-APCQQDSDGRPIAGVININPSYIPSFYFQEFFRTVIHEIAHALGFSS  226 (521)
T ss_dssp             S-SEEEEEE----STT-----EE-EEEEE-TTS-EEEEEEE--GGG---S--HHHHHHHHHHHHHHTT-SH
T ss_pred             CccEEEEEEEeeccCCc--eEEE-eehhhccCCCCeeEEEEEchhHccchhhhcccceeeeeeeeeeeecc
Confidence            57888888876653322  3322 334321    12233322111     122345799999999999755


No 85 
>cd06455 M3A_TOP Peptidase M3 Thimet oligopeptidase (TOP; PZ-peptidase; endo-oligopeptidase A; endopeptidase 24.15; soluble metallo-endopeptidase; EC 3.4.24.15) family also includes neurolysin (endopeptidase 24.16, microsomal endopeptidase, mitochondrial oligopeptidase M, neurotensin endopeptidase, soluble angiotensin II-binding protein, thimet oligopeptidase II) which hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A. TOP and neurolysin are neuropeptidases expressed abundantly in the testis, but also found in the liver, lung and kidney. They are involved in the metabolism of neuropeptides under 20 amino acid residues long and cleave most bioactive peptides at the same sites, but recognize different positions on some naturally occurring and synthetic peptides; they cleave at distinct sites on the 13-residue bioactive peptide neurotensin, which modulates central dopaminergic and cholinergic circuits.  TOP has been shown to degrade peptides released by the proteasom
Probab=52.34  E-value=7.2  Score=37.42  Aligned_cols=13  Identities=38%  Similarity=0.585  Sum_probs=11.5

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      -..|++||+||.+
T Consensus       263 ~V~TLfHEfGHal  275 (472)
T cd06455         263 EVETFFHEFGHVI  275 (472)
T ss_pred             HHHHHHHHHHHHH
Confidence            4689999999988


No 86 
>PF01432 Peptidase_M3:  Peptidase family M3 This Prosite motif covers only the active site. This family belongs to family M3 of the peptidase classification.;  InterPro: IPR001567 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M3 (clan MA(E)), subfamilies M3A and M3B. The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. The Thimet oligopeptidase family, is a large family of archaeal, bacterial and eukaryotic oligopeptidases that cleave medium sized peptides. The group contains:  mitochondrial intermediate peptidase (3.4.24.59 from EC) Neurolysin, mitochondrial precursor, (3.4.24.16 from EC) Thimet oligopeptidase (3.4.24.15 from EC) Dipeptidyl carboxypeptidase (3.4.15.5 from EC) Oligopeptidase A (3.4.24.70 from EC) Oligoendopeptidase F ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QR4_B 3CE2_A 1Y79_1 2H1J_A 2H1N_A 2O36_A 1S4B_P 2O3E_A 1I1I_P.
Probab=51.74  E-value=7.5  Score=36.97  Aligned_cols=12  Identities=42%  Similarity=0.786  Sum_probs=11.0

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..|++||+||.+
T Consensus       243 v~tLfHE~GHa~  254 (458)
T PF01432_consen  243 VETLFHEFGHAM  254 (458)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHhHHH
Confidence            589999999987


No 87 
>TIGR02414 pepN_proteo aminopeptidase N, Escherichia coli type. The M1 family of zinc metallopeptidases contains a number of distinct, well-separated clades of proteins with aminopeptidase activity. Several are designated aminopeptidase N, EC 3.4.11.2, after the Escherichia coli enzyme, suggesting a similar activity profile. This family consists of all aminopeptidases closely related to E. coli PepN and presumed to have similar (not identical) function. Nearly all are found in Proteobacteria, but members are found also in Cyanobacteria, plants, and apicomplexan parasites. This family differs greatly in sequence from the family of aminopeptidases typified by Streptomyces lividans PepN (TIGR02412), from the membrane bound aminopeptidase N family in animals, etc.
Probab=51.66  E-value=27  Score=36.30  Aligned_cols=14  Identities=36%  Similarity=0.506  Sum_probs=12.0

Q ss_pred             HHHHHHHHHhhhhc
Q psy1606         214 LVATTVAHEMGHNL  227 (285)
Q Consensus       214 ~~a~~~AHElGH~l  227 (285)
                      .++.++|||++|+.
T Consensus       282 ~i~~VIaHElaHqW  295 (863)
T TIGR02414       282 RIESVIAHEYFHNW  295 (863)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35689999999997


No 88 
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=51.58  E-value=13  Score=28.20  Aligned_cols=35  Identities=26%  Similarity=0.448  Sum_probs=20.4

Q ss_pred             CCCCcccccCceeecCCCchhHHHHHHHHHhhhhcC
Q psy1606         193 GPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLG  228 (285)
Q Consensus       193 g~~C~~~~~~~v~~~~~~~~~~~a~~~AHElGH~lG  228 (285)
                      +..|. .+.+-|.-|....--+--.|+|||+.|..-
T Consensus        58 ~~LCG-~~~~~i~IDP~~~~KGC~~TL~HEL~H~WQ   92 (141)
T PHA02456         58 QDLCG-QFVGWIEIDPDYANKGCRDTLAHELNHAWQ   92 (141)
T ss_pred             cchhh-cceeEEEECCcccccchHHHHHHHHHHHHh
Confidence            44565 334444444443223345799999999863


No 89 
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=51.34  E-value=7.3  Score=36.45  Aligned_cols=12  Identities=50%  Similarity=0.869  Sum_probs=10.5

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..|++||+||.+
T Consensus       223 v~tl~HE~GHa~  234 (427)
T cd06459         223 VFTLAHELGHAF  234 (427)
T ss_pred             HHHHHHHhhHHH
Confidence            589999999975


No 90 
>PF13398 Peptidase_M50B:  Peptidase M50B-like
Probab=50.63  E-value=10  Score=31.95  Aligned_cols=16  Identities=38%  Similarity=0.605  Sum_probs=12.6

Q ss_pred             HHHHHHHHhhhhcCCC
Q psy1606         215 VATTVAHEMGHNLGME  230 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~  230 (285)
                      ...|+.||+||.+-.-
T Consensus        22 ~l~t~~HE~gHal~a~   37 (200)
T PF13398_consen   22 LLVTFVHELGHALAAL   37 (200)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4579999999988543


No 91 
>PRK14015 pepN aminopeptidase N; Provisional
Probab=50.05  E-value=34  Score=35.59  Aligned_cols=14  Identities=36%  Similarity=0.506  Sum_probs=12.0

Q ss_pred             HHHHHHHHHhhhhc
Q psy1606         214 LVATTVAHEMGHNL  227 (285)
Q Consensus       214 ~~a~~~AHElGH~l  227 (285)
                      .++.++|||++|+.
T Consensus       295 ~i~~vIaHElaHqW  308 (875)
T PRK14015        295 RIESVIAHEYFHNW  308 (875)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35689999999987


No 92 
>PF08219 TOM13:  Outer membrane protein TOM13;  InterPro: IPR013262 The TOM13 family of proteins are mitochondrial outer membrane proteins that mediate the assembly of beta-barrel proteins [].; GO: 0005741 mitochondrial outer membrane
Probab=49.91  E-value=13  Score=26.02  Aligned_cols=18  Identities=28%  Similarity=0.289  Sum_probs=14.9

Q ss_pred             hHHHHHHHHHhhhhcCCC
Q psy1606         213 GLVATTVAHEMGHNLGME  230 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG~~  230 (285)
                      .+++-++|||+++-+|-.
T Consensus        50 LGFGEl~AhE~~fr~gW~   67 (77)
T PF08219_consen   50 LGFGELFAHEIAFRLGWS   67 (77)
T ss_pred             HhHHHHHHHHHHHHhccC
Confidence            446789999999999873


No 93 
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional
Probab=49.49  E-value=24  Score=34.98  Aligned_cols=58  Identities=21%  Similarity=0.162  Sum_probs=31.3

Q ss_pred             CCCceeeeeeeecCCCceeccccCCCCcccc----cCceeecCCC-----chhHHHHHHHHHhhhhcCCC
Q psy1606         170 PNDNAQLLTGMTFSDGVVGKALKGPICTYEF----SGGVNVDHKN-----VVGLVATTVAHEMGHNLGME  230 (285)
Q Consensus       170 ~~D~a~llt~~~~~~~~~G~A~~g~~C~~~~----~~~v~~~~~~-----~~~~~a~~~AHElGH~lG~~  230 (285)
                      ..|+.+.++.+....   +.....+.|....    ..|+......     .......+++|||.|.||..
T Consensus       205 naD~vLYVta~P~~~---~~lA~A~~C~~~~d~RPi~G~iNinp~~i~s~~~~~~~rv~~HEi~HALGFS  271 (622)
T PTZ00257        205 NADFVLYVASVPSEP---GVLAWATTCQVFSDDHPAVGVMNIPAANIVSRYDQGTTRTVTHEVAHALGFS  271 (622)
T ss_pred             ccCEEEEEEEecCCC---CeeEEEEEeccccCCCceEEEEeeCHHHCCCccchHHHHHHHHHHHHHhcCC
Confidence            578888888765532   2222334454321    1232221110     01123579999999999984


No 94 
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=47.81  E-value=17  Score=30.80  Aligned_cols=26  Identities=23%  Similarity=0.061  Sum_probs=17.5

Q ss_pred             ceeecCCCchhHHHHHHHHHhhhhcC
Q psy1606         203 GVNVDHKNVVGLVATTVAHEMGHNLG  228 (285)
Q Consensus       203 ~v~~~~~~~~~~~a~~~AHElGH~lG  228 (285)
                      +|....+-.-..++.++|||++|.+=
T Consensus        81 ~Ilvl~GLPrll~gsiLAHE~mHa~L  106 (212)
T PF12315_consen   81 AILVLYGLPRLLTGSILAHELMHAWL  106 (212)
T ss_pred             EEEEECCCCHHHHhhHHHHHHHHHHh
Confidence            34444444445567899999999873


No 95 
>COG4784 Putative Zn-dependent protease [General function prediction only]
Probab=46.86  E-value=12  Score=34.21  Aligned_cols=18  Identities=50%  Similarity=0.693  Sum_probs=13.7

Q ss_pred             hHHHHHHHHHhhhhcCCCC
Q psy1606         213 GLVATTVAHEMGHNLGMEH  231 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG~~H  231 (285)
                      .-+|.+++|||||.- ++|
T Consensus       122 sEvAAVl~HEmgHVt-AnH  139 (479)
T COG4784         122 SEVAAVLAHEMGHVT-ANH  139 (479)
T ss_pred             HHHHHHHHhhhhhee-cch
Confidence            346889999999975 344


No 96 
>COG2321 Predicted metalloprotease [General function prediction only]
Probab=46.78  E-value=12  Score=33.14  Aligned_cols=14  Identities=43%  Similarity=0.551  Sum_probs=11.2

Q ss_pred             hHHHHHHHHHhhhh
Q psy1606         213 GLVATTVAHEMGHN  226 (285)
Q Consensus       213 ~~~a~~~AHElGH~  226 (285)
                      +..+.++|||+||-
T Consensus       165 fAqaYViAHEVGHH  178 (295)
T COG2321         165 FAQAYVIAHEVGHH  178 (295)
T ss_pred             HHHHHHHHhhhhHH
Confidence            34579999999984


No 97 
>cd06461 M2_ACE Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent dipeptidase that catalyzes the conversion of the decapeptide angiotensin I to the potent vasopressor ocatapeptide angiotensin II, by removing two C-terminal amino acids. There are two forms of the enzyme in humans, the ubiquitous somatic ACE and the sperm-specific germinal ACE, both encoded by the same gene through transcription from alternative promoters. Somatic ACE has two tandem active sites with distinct catalytic properties, whereas germinal ACE, the function of which is largely unknown, has just a single active site. Recently, an ACE homolog, ACE2, has been identified in humans that differs from ACE; it preferentially removes carboxy-terminal hydrophobic or basic amino acids and appears to be important in cardiac function. ACE homologs (also known as members of the M2 gluzincin family) have been found in a wide variety of species, including those that neither h
Probab=46.24  E-value=21  Score=34.40  Aligned_cols=12  Identities=58%  Similarity=0.645  Sum_probs=10.8

Q ss_pred             HHHHHHhhhhcC
Q psy1606         217 TTVAHEMGHNLG  228 (285)
Q Consensus       217 ~~~AHElGH~lG  228 (285)
                      .|+.||+||.+.
T Consensus       249 ~t~~HE~GH~~y  260 (477)
T cd06461         249 VTVHHEMGHIQY  260 (477)
T ss_pred             HHHHHHHHHHHH
Confidence            789999999994


No 98 
>PF13402 M60-like:  Peptidase M60-like family; PDB: 4FCA_A.
Probab=44.48  E-value=9.7  Score=34.00  Aligned_cols=14  Identities=36%  Similarity=0.337  Sum_probs=10.6

Q ss_pred             HHHHHHhhhhcCCC
Q psy1606         217 TTVAHEMGHNLGME  230 (285)
Q Consensus       217 ~~~AHElGH~lG~~  230 (285)
                      --++||+||++=..
T Consensus       221 WG~~HE~GH~~Q~~  234 (307)
T PF13402_consen  221 WGPWHELGHNHQQG  234 (307)
T ss_dssp             HHHHHHHHHHH-BG
T ss_pred             eeehhhhhhhcCcc
Confidence            46899999999544


No 99 
>cd06457 M3A_MIP Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3.4.24.59) belongs to the widespread subfamily M3A, that show similarity to the Thimet oligopeptidase (TOP). It is one of three peptidases responsible for the proteolytic processing of both, nuclear and mitochondrial encoded precursor polypeptides targeted to the various subcompartments of the mitochondria. It cleaves intermediate-size proteins initially processed by mitochondrial processing peptidase (MPP) to yield a processing intermediate with a typical N-terminal octapeptide that is sequentially cleaved by MIP to mature-size protein.  MIP cleaves precursor proteins of respiratory components, including subunits of the electron transport chain and tri-carboxylic acid cycle enzymes, and components of the mitochondrial genetic machinery, including ribosomal proteins, translation factors, and proteins required for mitochondrial DNA metabolism. It has been suggested that the human MIP (HMIP polypeptide; gene symbo
Probab=44.07  E-value=12  Score=35.88  Aligned_cols=13  Identities=46%  Similarity=0.746  Sum_probs=11.4

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      -+.|++||+||.+
T Consensus       248 ~v~TLfHEfGHal  260 (458)
T cd06457         248 EVETLFHEMGHAM  260 (458)
T ss_pred             HHHHHHHHHhHHH
Confidence            3689999999988


No 100
>COG2738 Predicted Zn-dependent protease [General function prediction only]
Probab=42.11  E-value=17  Score=30.46  Aligned_cols=18  Identities=33%  Similarity=0.547  Sum_probs=13.8

Q ss_pred             HHHHHHHhhhhcCCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~  233 (285)
                      ..++|||+||-+-=.||-
T Consensus        93 ~aVAAHEVGHAiQd~~~Y  110 (226)
T COG2738          93 IAVAAHEVGHAIQDQEDY  110 (226)
T ss_pred             HHHHHHHhhHHHhhhccc
Confidence            468999999998655543


No 101
>PF02163 Peptidase_M50:  Peptidase family M50;  InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry contains metallopeptidases belonging to MEROPS peptidase family M50 (S2P protease family, clan MM).  Members of the M50 metallopeptidase family include: mammalian sterol-regulatory element binding protein (SREBP) site 2 protease, Escherichia coli protease EcfE, stage IV sporulation protein FB and various hypothetical bacterial and eukaryotic homologues. A number of proteins are classified as non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3B4R_A 3ID4_A 3ID2_A 2ZPL_B 3ID1_A 2ZPM_A 3ID3_B 2HGA_A.
Probab=39.50  E-value=19  Score=29.63  Aligned_cols=19  Identities=32%  Similarity=0.478  Sum_probs=14.8

Q ss_pred             HHHHHHHHhhhhcCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~  233 (285)
                      ...++.||+||.+-+..=+
T Consensus         7 ~i~i~~HE~gH~~~a~~~G   25 (192)
T PF02163_consen    7 LISIVLHELGHALAARLYG   25 (192)
T ss_dssp             HHHHHHHHHHHHHHHHTTT
T ss_pred             ccccccccccccccccccc
Confidence            4578999999998766643


No 102
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins.  Smubp-2_like proteins also contain a helicase_like and an AN1-like Zinc finger domain and have been shown to bind single-stranded DNA. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA.
Probab=39.33  E-value=18  Score=24.18  Aligned_cols=20  Identities=30%  Similarity=0.667  Sum_probs=16.8

Q ss_pred             HHHHHHHhhhhcCCCCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTE  235 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~  235 (285)
                      --.+.|+|++.+|+.|...+
T Consensus        30 eR~~vH~lA~~~gL~s~S~G   49 (60)
T cd02641          30 DRLLVHELAEELGLRHESTG   49 (60)
T ss_pred             HHHHHHHHHHHcCCceEeeC
Confidence            36789999999999997654


No 103
>PTZ00337 surface protease GP63; Provisional
Probab=38.86  E-value=16  Score=35.98  Aligned_cols=17  Identities=41%  Similarity=0.688  Sum_probs=14.3

Q ss_pred             HHHHHHHHhhhhcCCCC
Q psy1606         215 VATTVAHEMGHNLGMEH  231 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~H  231 (285)
                      ...+++|||.|.||...
T Consensus       229 ~~~v~~HEi~HALGFs~  245 (567)
T PTZ00337        229 DVRVAAHELGHALGFVR  245 (567)
T ss_pred             HHHHHHHHHHHHHccCH
Confidence            34799999999999854


No 104
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=37.76  E-value=16  Score=33.46  Aligned_cols=12  Identities=42%  Similarity=0.750  Sum_probs=10.8

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      ..|++||+||.+
T Consensus       155 v~tl~HE~GHa~  166 (365)
T cd06258         155 INTLFHEFGHAV  166 (365)
T ss_pred             HHHHHHHHhHHH
Confidence            579999999988


No 105
>KOG2661|consensus
Probab=37.40  E-value=19  Score=32.71  Aligned_cols=15  Identities=33%  Similarity=0.552  Sum_probs=12.9

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      ..+|.++|||+||.+
T Consensus       273 dglAtvLgHE~aHaV  287 (424)
T KOG2661|consen  273 DGLATVLGHEIAHAV  287 (424)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            457899999999986


No 106
>cd06460 M32_Taq Peptidase family M32 is a subclass of metallocarboxypeptidases which are distributed mainly in bacteria and archaea, and contain a HEXXH motif that coordinates a divalent cation such as Zn2+ or Co2+, so far only observed in the active site of neutral metallopeptidases but not in carboxypeptidases. M32 includes the thermostable carboxypeptidases (E.C. 3.4.17.19) from Thermus aquaticus (TaqCP) and Pyrococcus furiosus (PfuCP), which have broad specificities toward a wide range of C-terminal substrates that include basic, aromatic, neutral and polar amino acids. These enzymes have a similar fold to the M3 peptidases such as neurolysin and the M2 angiotensin converting enzyme (ACE). Novel peptidases from protozoa Trypanosoma cruzi, a causative agent of Chagas' disease, and Leishmania major, a parasite that causes leishmaniasis, are the first eukaryotic M32 enzymes identified so far, thus making these enzymes an attractive potential target for drug development against these o
Probab=36.98  E-value=22  Score=33.30  Aligned_cols=20  Identities=30%  Similarity=0.429  Sum_probs=14.3

Q ss_pred             chhHHHHHHHHHhhhhc---CCC
Q psy1606         211 VVGLVATTVAHEMGHNL---GME  230 (285)
Q Consensus       211 ~~~~~a~~~AHElGH~l---G~~  230 (285)
                      ++.....+++||+||.+   |++
T Consensus       155 d~~~~l~t~iHE~GHalye~~l~  177 (396)
T cd06460         155 DFRSALFSTIHETGHALYEQGLP  177 (396)
T ss_pred             chHHHHHHHHHHhhHHHHHhcCC
Confidence            34444579999999987   554


No 107
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP.  Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Probab=36.00  E-value=24  Score=29.30  Aligned_cols=14  Identities=36%  Similarity=0.401  Sum_probs=11.2

Q ss_pred             HHHHHHHHhhhhcC
Q psy1606         215 VATTVAHEMGHNLG  228 (285)
Q Consensus       215 ~a~~~AHElGH~lG  228 (285)
                      ...++.||+||-+=
T Consensus         9 ~~~v~iHElGH~~~   22 (182)
T cd06163           9 GILIFVHELGHFLV   22 (182)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35789999999763


No 108
>KOG1047|consensus
Probab=34.48  E-value=24  Score=34.34  Aligned_cols=12  Identities=33%  Similarity=0.678  Sum_probs=11.1

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      +.+|||||+|+.
T Consensus       289 ~~vIaHEIAHSW  300 (613)
T KOG1047|consen  289 VDVIAHEIAHSW  300 (613)
T ss_pred             hhHHHHHhhhhh
Confidence            689999999987


No 109
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-bindin
Probab=34.44  E-value=26  Score=28.61  Aligned_cols=17  Identities=29%  Similarity=0.556  Sum_probs=13.3

Q ss_pred             HHHHHHHHhhhhcCCCC
Q psy1606         215 VATTVAHEMGHNLGMEH  231 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~H  231 (285)
                      ...++.||+||-+=+..
T Consensus         8 ~i~i~iHE~gH~~~A~~   24 (180)
T cd05709           8 LISVTVHELGHALVARR   24 (180)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45789999999985544


No 110
>PF14891 Peptidase_M91:  Effector protein
Probab=34.16  E-value=18  Score=29.59  Aligned_cols=21  Identities=19%  Similarity=0.127  Sum_probs=16.4

Q ss_pred             HHHHHHHHHhhhhcCCCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD~~  234 (285)
                      .-+++++|||+|..-..++..
T Consensus       102 ~p~v~L~HEL~HA~~~~~Gt~  122 (174)
T PF14891_consen  102 PPFVVLYHELIHAYDYMNGTM  122 (174)
T ss_pred             HHHHHHHHHHHHHHHHHCCCC
Confidence            346899999999987776654


No 111
>PF00480 ROK:  ROK family;  InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames []. This family, known as ROK (Repressor, ORF, Kinase) includes the xylose operon repressor, xylR, from Bacillus subtilis, Lactobacillus pentosus and Staphylococcus xylosus; N-acetylglucosamine repressor, nagC, from Escherichia coli; glucokinase 2.7.1.2 from EC from Streptomyces coelicolor; fructokinase 2.7.1.4 from EC from Pediococcus pentosaceus, Streptococcus mutans and Zymomonas mobilis; allokinase 2.7.1.55 from EC and mlc from E. coli; and E. coli hypothetical proteins yajF and yhcI and the corresponding Haemophilus influenzae proteins. The repressor proteins (xylR and nagC) from this family possess an N-terminal region not present in the sugar kinases and which contains an helix-turn-helix DNA-binding motif.; PDB: 2GUP_A 3LM2_B 3EO3_A 2YHY_A 2YHW_A 2YI1_A 3MCP_A 1Z05_A 3HTV_A 3OHR_A ....
Probab=33.14  E-value=19  Score=29.11  Aligned_cols=28  Identities=25%  Similarity=0.593  Sum_probs=19.4

Q ss_pred             HHHHHHhhhhcCCCCCCCCCCCCCCCccc
Q psy1606         217 TTVAHEMGHNLGMEHDTTECTCPSDRCIM  245 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~~~c~C~~~~cIM  245 (285)
                      .-.|-|+||.. +..++..|.|+..+|+-
T Consensus       144 ~~~aGeigh~~-~~~~~~~c~cG~~GClE  171 (179)
T PF00480_consen  144 NGFAGEIGHMP-VDPNGEPCYCGNRGCLE  171 (179)
T ss_dssp             TS-TTGGGGSB-SSTTSSB-TTSSBSBHH
T ss_pred             Cccccceeeee-ccCCCCcCCCCCcCcHH
Confidence            34677899877 45556789999989974


No 112
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=33.10  E-value=28  Score=29.97  Aligned_cols=19  Identities=37%  Similarity=0.574  Sum_probs=14.3

Q ss_pred             HHHHHHHHHhhhhcCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHD  232 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD  232 (285)
                      .+..++.||+||.+=+.+=
T Consensus        52 l~~~v~iHElgH~~~A~~~   70 (227)
T cd06164          52 LFASVLLHELGHSLVARRY   70 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHc
Confidence            3467899999999855553


No 113
>cd06456 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70) enzyme. DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from E. coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called  peptidyl dipeptidase A). Oligopeptidase A (OpdA) may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala.
Probab=32.77  E-value=23  Score=33.56  Aligned_cols=13  Identities=54%  Similarity=0.774  Sum_probs=11.4

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      -..|++||+||.|
T Consensus       208 ~v~tLfHEfGHal  220 (422)
T cd06456         208 EVTTLFHEFGHAL  220 (422)
T ss_pred             HHHHHHHHHHHHH
Confidence            3589999999998


No 114
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=32.66  E-value=29  Score=29.37  Aligned_cols=19  Identities=32%  Similarity=0.490  Sum_probs=14.3

Q ss_pred             HHHHHHHHHhhhhcCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHD  232 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD  232 (285)
                      ....++.||+||.+=+.+=
T Consensus        37 l~~~v~iHElgH~~~A~~~   55 (208)
T cd06161          37 LFLSVLLHELGHALVARRY   55 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHc
Confidence            3468999999998855553


No 115
>KOG2414|consensus
Probab=31.69  E-value=18  Score=33.89  Aligned_cols=14  Identities=57%  Similarity=1.120  Sum_probs=11.5

Q ss_pred             HHhhhhcCCC-CCCC
Q psy1606         221 HEMGHNLGME-HDTT  234 (285)
Q Consensus       221 HElGH~lG~~-HD~~  234 (285)
                      |-+||.|||+ ||.+
T Consensus       402 HhVgHyLGmDVHD~p  416 (488)
T KOG2414|consen  402 HHVGHYLGMDVHDCP  416 (488)
T ss_pred             cccchhcCcccccCC
Confidence            6799999997 7764


No 116
>PF04450 BSP:  Peptidase of plants and bacteria;  InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=30.26  E-value=99  Score=26.19  Aligned_cols=81  Identities=20%  Similarity=0.165  Sum_probs=40.4

Q ss_pred             CCHHHHHHHHHHhhhhccCCC----CCCCceeeeeeeecCCCceeccccCCCCccc---ccCceeecCC---CchhHHHH
Q psy1606         148 VNGDITLTNFLSYRKDRLVLS----HPNDNAQLLTGMTFSDGVVGKALKGPICTYE---FSGGVNVDHK---NVVGLVAT  217 (285)
Q Consensus       148 ~~~~~~l~~f~~w~~~~~~~~----~~~D~a~llt~~~~~~~~~G~A~~g~~C~~~---~~~~v~~~~~---~~~~~~a~  217 (285)
                      +++..+|..-.......|+..    .+-+.+.|+.     ....|+|+..|-....   .|........   ..-.-+..
T Consensus        24 ~~a~~~L~~a~~~V~~~ly~~~~~~~~v~~Vt~~~-----~~~~gVA~t~gd~~~~~I~~S~~~i~~~~~~~~~~~Ei~G   98 (205)
T PF04450_consen   24 PDAEQVLRDASRFVWRLLYQSPADRKPVRSVTLIL-----DDMDGVAYTSGDDDHKEIHFSARYIAKYPADGDVRDEIIG   98 (205)
T ss_pred             cCHHHHHHHHHHHHHHHhCCCCCCCCcccEEEEEE-----ECCCeeEEEecCCCccEEEEeHHHHhhcccccchHHHHHH
Confidence            466666666554444444432    2234455544     2356889888722110   0111111111   11123457


Q ss_pred             HHHHHhhhhcCCCCCCCC
Q psy1606         218 TVAHEMGHNLGMEHDTTE  235 (285)
Q Consensus       218 ~~AHElGH~lG~~HD~~~  235 (285)
                      ++.|||.|..  .+|+.+
T Consensus        99 vl~HE~~H~~--Q~~~~~  114 (205)
T PF04450_consen   99 VLYHEMVHCW--QWDGRG  114 (205)
T ss_pred             HHHHHHHHHh--hcCCCC
Confidence            9999999996  555543


No 117
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=29.85  E-value=33  Score=30.24  Aligned_cols=19  Identities=26%  Similarity=0.401  Sum_probs=14.3

Q ss_pred             HHHHHHHHhhhhcCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~  233 (285)
                      ...++.||+||-+=+.+-+
T Consensus       118 ~isv~iHElgHa~~Ar~~G  136 (263)
T cd06159         118 VVGVVVHELSHGILARVEG  136 (263)
T ss_pred             HHHHHHHHHHHHHHHHHcC
Confidence            3578999999998665543


No 118
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=29.56  E-value=29  Score=27.52  Aligned_cols=16  Identities=25%  Similarity=0.258  Sum_probs=12.4

Q ss_pred             HHHHHHHHHhhhhcCC
Q psy1606         214 LVATTVAHEMGHNLGM  229 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~  229 (285)
                      .+..|+.|||.|..=.
T Consensus        58 ~l~~~l~HEm~H~~~~   73 (146)
T smart00731       58 RLRETLLHELCHAALY   73 (146)
T ss_pred             HHHhhHHHHHHHHHHH
Confidence            3456999999998844


No 119
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=29.52  E-value=35  Score=28.30  Aligned_cols=20  Identities=40%  Similarity=0.524  Sum_probs=15.3

Q ss_pred             HHHHHHHHHhhhhcCCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD~  233 (285)
                      ....++.||+||-+-+..=+
T Consensus        40 l~~~l~iHElgH~~~A~~~G   59 (183)
T cd06160          40 LLAILGIHEMGHYLAARRHG   59 (183)
T ss_pred             HHHHHHHHHHHHHHHHHHCC
Confidence            34678999999998776543


No 120
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=29.31  E-value=35  Score=29.25  Aligned_cols=13  Identities=54%  Similarity=0.790  Sum_probs=11.0

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      +..|+-||+||.|
T Consensus        92 ~~~~l~HE~GHAl  104 (220)
T PF14247_consen   92 VLFTLYHELGHAL  104 (220)
T ss_pred             HHHHHHHHHHHHH
Confidence            4579999999976


No 121
>TIGR02412 pepN_strep_liv aminopeptidase N, Streptomyces lividans type. This family is a subset of the members of the zinc metallopeptidase family M1 (pfam01433), with a single member characterized in Streptomyces lividans 66 and designated aminopeptidase N. The spectrum of activity may differ somewhat from the aminopeptidase N clade of E. coli and most other Proteobacteria, well separated phylogenetically within the M1 family. The M1 family also includes leukotriene A-4 hydrolase/aminopeptidase (with a bifunctional active site).
Probab=29.00  E-value=94  Score=32.24  Aligned_cols=14  Identities=36%  Similarity=0.375  Sum_probs=11.7

Q ss_pred             HHHHHHHHHhhhhc
Q psy1606         214 LVATTVAHEMGHNL  227 (285)
Q Consensus       214 ~~a~~~AHElGH~l  227 (285)
                      ..+.++||||+|..
T Consensus       286 ~~~~viaHElAHqW  299 (831)
T TIGR02412       286 NRAGVILHEMAHMW  299 (831)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35689999999976


No 122
>PF02130 UPF0054:  Uncharacterized protein family UPF0054;  InterPro: IPR002036 These, as yet, uncharacterised proteins are of 17 to 21 kDa. They contain a conserved region with three histidines at the C terminus. The protein family is represented by a single member sequence only in nearly every bacterium. The crystal structure of the protein from the hyperthermophilic bacteria Aquifex aeolicus has been determined. The overall fold consists of one central alpha-helix surrounded by a four-stranded beta-sheet and four other alpha-helices. Structure-based homology analysis reveals a good resemblance to the metal-dependent proteinases such as collagenases and gelatinases. However, experimental tests for collagenase and gelatinase-type function show no detectable activity under standard assay conditions [].; GO: 0046872 metal ion binding; PDB: 1TVI_A 1OZ9_A 1XM5_A 1XAX_A.
Probab=28.91  E-value=51  Score=26.16  Aligned_cols=19  Identities=37%  Similarity=0.623  Sum_probs=16.3

Q ss_pred             HHHHHHHHhhhhcCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDT  233 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~  233 (285)
                      ++..++|-+-|++|-+|..
T Consensus       108 l~~l~vHG~LHLlGyDH~~  126 (145)
T PF02130_consen  108 LARLLVHGLLHLLGYDHET  126 (145)
T ss_dssp             HHHHHHHHHHHHTT-SSTT
T ss_pred             HhHHHHHHHHHHcCCCCCC
Confidence            5789999999999999975


No 123
>KOG1046|consensus
Probab=28.63  E-value=92  Score=32.57  Aligned_cols=15  Identities=40%  Similarity=0.598  Sum_probs=12.9

Q ss_pred             hHHHHHHHHHhhhhc
Q psy1606         213 GLVATTVAHEMGHNL  227 (285)
Q Consensus       213 ~~~a~~~AHElGH~l  227 (285)
                      ..+|.+|||||+|..
T Consensus       322 ~~va~vIaHElAHQW  336 (882)
T KOG1046|consen  322 QRVAEVIAHELAHQW  336 (882)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            457899999999985


No 124
>PRK00016 metal-binding heat shock protein; Provisional
Probab=28.01  E-value=48  Score=26.85  Aligned_cols=20  Identities=30%  Similarity=0.405  Sum_probs=17.7

Q ss_pred             HHHHHHHHhhhhcCCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~  234 (285)
                      ++.+++|-+-|++|-+|...
T Consensus       113 ~~~l~iHG~LHLlGYDH~~~  132 (159)
T PRK00016        113 LAHLTVHGILHLLGYDHIED  132 (159)
T ss_pred             HHHHHHHhhHHhcCCCCCCh
Confidence            57899999999999999753


No 125
>TIGR00043 metalloprotein, YbeY/UPF0054 family. This minimally protein family is represented by a single member sequence only in nearly every bacterium. Crystallography demonstrates metal-binding activity, possibly to nickel. It is a predicted to be a metallohydrolase, and somewhat more weakly to be a metalloproteinase.
Probab=26.71  E-value=58  Score=24.59  Aligned_cols=21  Identities=33%  Similarity=0.488  Sum_probs=18.1

Q ss_pred             HHHHHHHHHhhhhcCCCCCCC
Q psy1606         214 LVATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~~HD~~  234 (285)
                      -++.+++|-+=|++|-+|...
T Consensus        72 e~~~l~iHG~LHLlGyDH~~~   92 (110)
T TIGR00043        72 ELAHLTVHGLLHLLGYDHETE   92 (110)
T ss_pred             HHHHHHHHHHHHHcCCCCCCh
Confidence            357899999999999999753


No 126
>PF10463 Peptidase_U49:  Peptidase U49;  InterPro: IPR019504 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported.  This entry contains peptidases belonging to MEROPS peptidase family U49 (Lit peptidase, clan U-). The Lit peptidase from Escherichia coli functions in bacterial cell death in response to infection by Enterobacteria phage T4. Following binding of Gol peptide to domains II and III of elongation factor Tu, the Lit peptidase cleaves domain I of the elongation factor. This prevents binding of guanine nucleotides, shuts down translation and leads to cell death. 
Probab=26.26  E-value=46  Score=28.27  Aligned_cols=19  Identities=26%  Similarity=0.532  Sum_probs=14.6

Q ss_pred             HHHHHHHHhhhhcCCCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHDTT  234 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD~~  234 (285)
                      .+.+++||++| +=+.|.+.
T Consensus       101 ~~fil~HE~~H-v~~~h~~~  119 (206)
T PF10463_consen  101 IAFILLHELAH-VVLGHEGD  119 (206)
T ss_pred             HHHHHHHHHHH-HHHcCccc
Confidence            57899999999 44666654


No 127
>PRK04860 hypothetical protein; Provisional
Probab=26.23  E-value=32  Score=27.95  Aligned_cols=13  Identities=38%  Similarity=0.675  Sum_probs=9.9

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      +..||+|||.|..
T Consensus        63 l~~~v~HEl~H~~   75 (160)
T PRK04860         63 IDEVVPHELAHLL   75 (160)
T ss_pred             HHhHHHHHHHHHH
Confidence            4578899999863


No 128
>PRK04351 hypothetical protein; Provisional
Probab=26.02  E-value=38  Score=27.15  Aligned_cols=13  Identities=23%  Similarity=0.365  Sum_probs=10.8

Q ss_pred             HHHHHHHHHhhhh
Q psy1606         214 LVATTVAHEMGHN  226 (285)
Q Consensus       214 ~~a~~~AHElGH~  226 (285)
                      .+..|++|||.|.
T Consensus        60 ~l~~vv~HElcH~   72 (149)
T PRK04351         60 ELIGIIKHELCHY   72 (149)
T ss_pred             HHHhhHHHHHHHH
Confidence            3467999999997


No 129
>TIGR02411 leuko_A4_hydro leukotriene A-4 hydrolase/aminopeptidase. Members of this family represent a distinctive subset within the zinc metallopeptidase family M1 (pfam01433). The majority of the members of pfam01433 are aminopeptidases, but the sequences in this family for which the function is known are leukotriene A-4 hydrolase. A dual epoxide hydrolase and aminopeptidase activity at the same active site is indicated. The physiological substrate for aminopeptidase activity is not known.
Probab=25.71  E-value=35  Score=33.90  Aligned_cols=12  Identities=33%  Similarity=0.686  Sum_probs=10.7

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      +.++||||+|+.
T Consensus       280 ~~viaHElAHqW  291 (601)
T TIGR02411       280 VDVIAHELAHSW  291 (601)
T ss_pred             hhhHHHHHHhhc
Confidence            479999999997


No 130
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF). NRF is a nuclear inhibitor of NF-kappaB proteins that can silence the IFNbeta promoter via binding to a negative regulatory element (NRE). Beside R3H NRF also contains a G-patch domain. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=25.68  E-value=44  Score=22.29  Aligned_cols=20  Identities=10%  Similarity=0.385  Sum_probs=16.7

Q ss_pred             HHHHHHHhhhhcCCCCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTE  235 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~  235 (285)
                      --.+-|++++.+|+.|-..+
T Consensus        30 eR~~vH~~a~~~gL~s~S~G   49 (60)
T cd02640          30 ERALIHQIAQKYGLKSRSYG   49 (60)
T ss_pred             HHHHHHHHHHHcCCceeeEe
Confidence            35789999999999997654


No 131
>PF10026 DUF2268:  Predicted Zn-dependent protease (DUF2268);  InterPro: IPR018728  This domain, found in various hypothetical bacterial proteins, as well as predicted zinc dependent proteases, has no known function. 
Probab=25.33  E-value=1.3e+02  Score=25.02  Aligned_cols=16  Identities=31%  Similarity=0.389  Sum_probs=13.1

Q ss_pred             hHHHHHHHHHhhhhcC
Q psy1606         213 GLVATTVAHEMGHNLG  228 (285)
Q Consensus       213 ~~~a~~~AHElGH~lG  228 (285)
                      ..+..++|||+-|+.=
T Consensus        63 ~~l~~~iaHE~hH~~r   78 (195)
T PF10026_consen   63 EELPALIAHEYHHNCR   78 (195)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3467899999999973


No 132
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=25.30  E-value=47  Score=22.11  Aligned_cols=20  Identities=20%  Similarity=0.456  Sum_probs=17.0

Q ss_pred             HHHHHHHhhhhcCCCCCCCC
Q psy1606         216 ATTVAHEMGHNLGMEHDTTE  235 (285)
Q Consensus       216 a~~~AHElGH~lG~~HD~~~  235 (285)
                      --.+-|++++.+|+.|...+
T Consensus        29 eR~~vH~~a~~~gL~s~S~G   48 (59)
T cd06007          29 ERAVIHRLCRKLGLKSKSKG   48 (59)
T ss_pred             HHHHHHHHHHHcCCCceeec
Confidence            36789999999999998654


No 133
>COG0339 Dcp Zn-dependent oligopeptidases [Amino acid transport and metabolism]
Probab=24.65  E-value=28  Score=34.78  Aligned_cols=12  Identities=58%  Similarity=0.911  Sum_probs=11.0

Q ss_pred             HHHHHHHhhhhc
Q psy1606         216 ATTVAHEMGHNL  227 (285)
Q Consensus       216 a~~~AHElGH~l  227 (285)
                      +.|+=||+||-|
T Consensus       468 V~TLFHEfGHgL  479 (683)
T COG0339         468 VTTLFHEFGHGL  479 (683)
T ss_pred             HHHHHHHhhhHH
Confidence            689999999987


No 134
>PRK10911 oligopeptidase A; Provisional
Probab=24.53  E-value=37  Score=34.30  Aligned_cols=13  Identities=46%  Similarity=0.713  Sum_probs=11.5

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      -..|+.||+||.|
T Consensus       463 ~v~tlfHEfGHal  475 (680)
T PRK10911        463 EVITLFHEFGHGL  475 (680)
T ss_pred             HHHHHHHHHhHHH
Confidence            3589999999998


No 135
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=23.87  E-value=47  Score=26.27  Aligned_cols=16  Identities=31%  Similarity=0.428  Sum_probs=12.8

Q ss_pred             HHHHHHHHHhhhhcCC
Q psy1606         214 LVATTVAHEMGHNLGM  229 (285)
Q Consensus       214 ~~a~~~AHElGH~lG~  229 (285)
                      .+-.|++|||.|..=-
T Consensus        59 ~~~~tL~HEm~H~~~~   74 (157)
T PF10263_consen   59 ELIDTLLHEMAHAAAY   74 (157)
T ss_pred             HHHHHHHHHHHHHHhh
Confidence            4568999999998753


No 136
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase). This alignment models one branch of the ROK superfamily of proteins. The three members of the seed alignment for this model all have experimental evidence for activity as glucokinase, but the set of related proteins is crowded with paralogs of different or unknown function. Proteins scoring above the trusted_cutoff will show strong similarity to at least one known glucokinase and may be designated as putative glucokinases. However, definitive identification of glucokinases should be done only with extreme caution.
Probab=23.39  E-value=28  Score=31.12  Aligned_cols=29  Identities=34%  Similarity=0.610  Sum_probs=21.5

Q ss_pred             HHHHHHhhhhcCCCCCC-CCCCCCCCCcccC
Q psy1606         217 TTVAHEMGHNLGMEHDT-TECTCPSDRCIMA  246 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~-~~c~C~~~~cIM~  246 (285)
                      .-.|-|+||.. +..++ ..|.|++.+|+-.
T Consensus       150 ~g~agEiGh~~-v~~~g~~~C~cG~~gclE~  179 (318)
T TIGR00744       150 NGVGAEIGHIR-MVPDGRLLCNCGKQGCIET  179 (318)
T ss_pred             CCCCcccCceE-eCCCCCcccCCCCcchHHH
Confidence            34678999986 34566 6899999888754


No 137
>PLN02791 Nudix hydrolase homolog
Probab=23.23  E-value=47  Score=33.98  Aligned_cols=17  Identities=29%  Similarity=0.524  Sum_probs=14.8

Q ss_pred             HHHHHHHHhhhhcCCCC
Q psy1606         215 VATTVAHEMGHNLGMEH  231 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~H  231 (285)
                      ...|+-||+||.+|=.+
T Consensus       585 ~~~v~lHElgHGsG~~~  601 (770)
T PLN02791        585 FTHTICHECCHGIGPHT  601 (770)
T ss_pred             HHHHHHHHhhccccccc
Confidence            36899999999999866


No 138
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=22.28  E-value=56  Score=29.08  Aligned_cols=18  Identities=33%  Similarity=0.645  Sum_probs=13.7

Q ss_pred             HHHHHHHHhhhhcCCCCC
Q psy1606         215 VATTVAHEMGHNLGMEHD  232 (285)
Q Consensus       215 ~a~~~AHElGH~lG~~HD  232 (285)
                      +..++.||+||.+=+..-
T Consensus       135 ~isvvvHElgHal~A~~~  152 (277)
T cd06162         135 LISGVVHEMGHGVAAVRE  152 (277)
T ss_pred             HHHHHHHHHHHHHHHHHc
Confidence            347899999999866543


No 139
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]
Probab=21.88  E-value=32  Score=30.69  Aligned_cols=32  Identities=25%  Similarity=0.443  Sum_probs=22.3

Q ss_pred             HHHHHHhhhhcCCCCCCCCCCCCCCCcccCCCCC
Q psy1606         217 TTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSS  250 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~  250 (285)
                      .-.|+|+||..=..+..  |.|++.+|+-.....
T Consensus       159 ~g~age~Gh~~v~~~g~--c~cG~~GclE~~as~  190 (314)
T COG1940         159 NGNAGEIGHMVVDPDGE--CGCGRRGCLETYASG  190 (314)
T ss_pred             CCccccccceEECCCCc--cCCCCCCchHHhccH
Confidence            44688999986333322  999999998766543


No 140
>PRK05082 N-acetylmannosamine kinase; Provisional
Probab=20.62  E-value=38  Score=29.88  Aligned_cols=31  Identities=26%  Similarity=0.510  Sum_probs=23.2

Q ss_pred             HHHHHHhhhhcCCCCCCCCCCCCCCCcccCCC
Q psy1606         217 TTVAHEMGHNLGMEHDTTECTCPSDRCIMAPS  248 (285)
Q Consensus       217 ~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~  248 (285)
                      .-.|-|+||..-.+ ++..|.|++.+|+-...
T Consensus       148 ~g~AGEiGh~~v~~-~g~~c~CG~~GclE~~~  178 (291)
T PRK05082        148 GGLAGHIGHTLADP-HGPVCGCGRRGCVEAIA  178 (291)
T ss_pred             CCccccccceEecC-CCCCCCCCCcCchhhhc
Confidence            35788999987433 35689999999987654


No 141
>TIGR00054 RIP metalloprotease RseP. A model that detects fragments as well matches a number of members of the PEPTIDASE FAMILY S2C. The region of match appears not to overlap the active site domain.
Probab=20.23  E-value=60  Score=30.63  Aligned_cols=13  Identities=38%  Similarity=0.626  Sum_probs=10.9

Q ss_pred             HHHHHHHHhhhhc
Q psy1606         215 VATTVAHEMGHNL  227 (285)
Q Consensus       215 ~a~~~AHElGH~l  227 (285)
                      ...++.||+||-+
T Consensus        14 ~~~v~~HE~gH~~   26 (420)
T TIGR00054        14 AVLIFVHELGHFL   26 (420)
T ss_pred             HHHHHHHhHHHHH
Confidence            4578999999975


No 142
>COG4823 AbiF Abortive infection bacteriophage resistance protein [Defense mechanisms]
Probab=20.19  E-value=54  Score=28.79  Aligned_cols=14  Identities=36%  Similarity=0.560  Sum_probs=11.4

Q ss_pred             HHHHHHHhhhhcCC
Q psy1606         216 ATTVAHEMGHNLGM  229 (285)
Q Consensus       216 a~~~AHElGH~lG~  229 (285)
                      -.+|||++||+-|.
T Consensus        93 Ks~iAyllg~~~gp  106 (299)
T COG4823          93 KSVIAYLLGHNCGP  106 (299)
T ss_pred             HHHHHHHhccccCc
Confidence            36899999998763


Done!