Diaphorina citri psyllid: psy16095


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MVIAIGFEGSANKLGIGIVDTKKNTILSNCRRTYVTPPGEGFLPRETAQHHKSKVLEEKFDYLSQNQRGKGSIGKKNTILSNCRRTYVTPPGEGFLPRETAQHHKSKVLEVLKEALDQAKVSRDDIDVICYTKGPGMGGPLTVVAIVARTLALLWNKPIVGVNHCIGHIEMGRNVTKCENPTVLYVSGGNTQVIAYSRQRYRIFGETIDIAVGNCLDRFARVLKLSNDPSPGYNIEQMAKK
cEEEEEcccccccCEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccCEEEEEccccCEEEEccEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHHHHHHHHccccccEEccHHHHHccccccccccccEEEEEEcccEEEEEEEcccEEEEccccHHHHHHHHHHHHHHcccccccccHHHHHHHHcc
MVIAIGFEGSANKLGIGIVDTKKNTILSNCRRTYVTPP*********************FDYLSQNQRGKGSIGKKNTILSNCRRTYVTPPGEGFLPRETAQHHKSKVLEVLKEALDQAKVSRDDIDVICYTKGPGMGGPLTVVAIVARTLALLWNKPIVGVNHCIGHIEMGRNVTKCENPTVLYVSGGNTQVIAYSRQRYRIFGETIDIAVGNCLDRFARVLKLSNDPSPGYNIEQMAK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIAIGFEGSANKLGIGIVDTKKNTILSNCRRTYVTPPGEGFLPRETAQHHKSKVLEEKFDYLSQNQRGKGSIGKKNTILSNCRRTYVTPPGEGFLPRETAQHHKSKVLEVLKEALDQAKVSRDDIDVICYTKGPGMGGPLTVVAIVARTLALLWNKPIVGVNHCIGHIEMGRNVTKCENPTVLYVSGGNTQVIAYSRQRYRIFGETIDIAVGNCLDRFARVLKLSNDPSPGYNIEQMAKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine.confidentQ9NPF4
Probable tRNA threonylcarbamoyladenosine biosynthesis protein Osgep (Fragment) Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine.confidentQ9WVS2
Probable tRNA threonylcarbamoyladenosine biosynthesis protein Osgep Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine.confidentQ8BWU5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0031490 [MF]chromatin DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003682, GO:1901363
GO:0000408 [CC]EKC/KEOPS complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004222 [MF]metalloendopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008237
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0008033 [BP]tRNA processingprobableGO:0016070, GO:0006139, GO:0044238, GO:0034470, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0006399, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0034660, GO:0006396, GO:0046483
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0000723 [BP]telomere maintenanceprobableGO:0060249, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0042592, GO:0065007, GO:0044699, GO:0065008, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0032200, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0070525 [BP]threonylcarbamoyladenosine metabolic processprobableGO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:0046085, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:1901657

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ENO, chain A
Confidence level:very confident
Coverage over the Query: 1-22,78-240
View the alignment between query and template
View the model in PyMOL