Diaphorina citri psyllid: psy16096


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MFGYEPEIYYPKPPSKELYVNLLHQCKSLDIPVSESLPAETSVFHLIVDAIFGFSYKPPLRELFVPVINLFKSTKIPVVSIDIPSGWNVEHGPVEHKYQPHTLISLTAPKLCAHKFEGKHHFLGGRFIPKQLEKEYDLNLPPYKGTDTYVKIDD
ccccCEEEEECccccHHHHHHHHHHHHHcccccccccccccccccEEEEEECcccccccccccHHHHHHHHHcccccEEEEEcccccccccccccccCCccEEEEEcccccccccccccEEEEEEECccHHHHHHHccccccccccccEEEccc
MFGYEPEIYYPKPPSKELYVNLLHQCKSLDIPVSESLPAETSVFHLIVDAIFGFSYKPPLRELFVPVINLFKSTKIPVVSIDIPSGWNVEHGPVEHKYQPHTLISLTAPKLCAHKFEGKHHFLGGRFIPKQLEKEYDLNLPPYKGTDTYVKIDD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGYEPEIYYPKPPSKELYVNLLHQCKSLDIPVSESLPAETSVFHLIVDAIFGFSYKPPLRELFVPVINLFKSTKIPVVSIDIPSGWNVEHGPVEHKYQPHTLISLTAPKLCAHKFEGKHHFLGGRFIPKQLEKEYDLNLPPYKGTDTYVKIDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD(P)H-hydrate epimerase Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.confidentQ7Q0G5
NAD(P)H-hydrate epimerase Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.confidentQ9W2Y3
NAD(P)H-hydrate epimerase Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.confidentF7DL67

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0046496 [BP]nicotinamide nucleotide metabolic processprobableGO:0006732, GO:0006733, GO:0034641, GO:0006807, GO:0044281, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0071704, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0019362
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O8N, chain A
Confidence level:very confident
Coverage over the Query: 2-153
View the alignment between query and template
View the model in PyMOL