Query psy16098
Match_columns 99
No_of_seqs 77 out of 79
Neff 3.9
Searched_HMMs 46136
Date Fri Aug 16 20:48:37 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy16098.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16098hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG1425|consensus 99.9 6E-26 1.3E-30 187.5 3.3 86 8-99 5-98 (430)
2 PF09151 DUF1936: Domain of un 78.4 1.3 2.9E-05 26.0 1.3 12 17-28 12-23 (36)
3 PF12621 DUF3779: Phosphate me 49.6 14 0.0003 25.0 2.0 7 39-45 88-94 (95)
4 PF11250 DUF3049: Protein of u 48.5 21 0.00045 22.6 2.5 31 6-36 2-38 (56)
5 PF14167 YfkD: YfkD-like prote 45.9 9.9 0.00021 30.5 0.9 18 17-34 175-192 (232)
6 TIGR03678 het_cyc_patell bacte 44.0 11 0.00024 22.1 0.7 20 1-20 3-24 (34)
7 PF00571 CBS: CBS domain CBS d 26.6 46 0.001 18.7 1.4 13 15-27 30-42 (57)
8 COG0263 ProB Glutamate 5-kinas 26.0 46 0.00099 28.4 1.8 21 14-34 128-148 (369)
9 PF15650 Tox-REase-9: Restrict 21.1 46 0.00099 23.2 0.8 17 32-48 28-44 (89)
10 PF15266 DUF4594: Domain of un 18.5 55 0.0012 25.3 0.8 9 91-99 78-86 (182)
No 1
>KOG1425|consensus
Probab=99.92 E-value=6e-26 Score=187.50 Aligned_cols=86 Identities=51% Similarity=0.791 Sum_probs=75.2
Q ss_pred CCCccccCCceeeeccccceeeeeeeEEEeecCCCCCCCCCCCCCCcchhHHhhhccccCCCCCC------CCCChHHHH
Q psy16098 8 SLGVQSTAGAVPVLNEKGEVTMKKVKVHRYVSGKRPDYAQGSSDSEDDDDEVVNRKSEFTSIPHI------PFEDPRLRR 81 (99)
Q Consensus 8 ~~~i~STAGAvpVrNeKge~smqKvKV~RYv~GKrPdyA~~~~sdede~~~fi~k~~~~~~~~~~------~~~DpRLRR 81 (99)
.++||| ||||+ +||+++||||||+|||+||+|+||+ ||++|++++|++.++....+|++ ..+||||||
T Consensus 5 ~~~~~s---aipvr-ekg~~~m~kvkv~ryv~gk~peya~--sseed~d~~~~~~~~~~~a~~ee~~~~~~~~ddprlrr 78 (430)
T KOG1425|consen 5 ASVIQS---AIPVR-EKGEGSMQKVKVRRYVSGKAPEYAR--SSEEDDDVDFIKDRKRDRAEPEEDEEDVARIDDPRLRR 78 (430)
T ss_pred cccccc---ccchh-hhcccccceeeeeeecCCCCccccc--ccccchhhhHHHHHHHHhcCcchhhcccccccCccccc
Confidence 567888 99999 9999999999999999999999999 55558888999998876666654 688999999
Q ss_pred hhhhc--chhhHHHHhhhcC
Q psy16098 82 LTSRK--QEDAEEDRRSRHR 99 (99)
Q Consensus 82 L~~r~--~~d~e~er~~rhr 99 (99)
|+.+. .+++|.++.++||
T Consensus 79 l~~~~~~~e~~E~e~~e~hr 98 (430)
T KOG1425|consen 79 LPQRPVRSEDVEGERSERHR 98 (430)
T ss_pred ccccccccchhhhhhhhhhh
Confidence 99986 5899988898886
No 2
>PF09151 DUF1936: Domain of unknown function (DUF1936); InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=78.44 E-value=1.3 Score=26.01 Aligned_cols=12 Identities=50% Similarity=0.833 Sum_probs=8.8
Q ss_pred ceeeecccccee
Q psy16098 17 AVPVLNEKGEVT 28 (99)
Q Consensus 17 AvpVrNeKge~s 28 (99)
-+||-|+||+|+
T Consensus 12 l~pvy~~kgeik 23 (36)
T PF09151_consen 12 LEPVYNQKGEIK 23 (36)
T ss_dssp EEEEE-TTS-EE
T ss_pred EEEeecCCCcEE
Confidence 689999999984
No 3
>PF12621 DUF3779: Phosphate metabolism protein ; InterPro: IPR022257 This domain family is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with PF02714 from PFAM. There are two completely conserved residues (W and D) that may be functionally important. This family is likely to be involved in phosphate metabolism however there is little accompanying literature to confirm this.
Probab=49.64 E-value=14 Score=24.95 Aligned_cols=7 Identities=57% Similarity=1.270 Sum_probs=6.5
Q ss_pred cCCCCCC
Q psy16098 39 SGKRPDY 45 (99)
Q Consensus 39 ~GKrPdy 45 (99)
.|..|||
T Consensus 88 ~~~PPd~ 94 (95)
T PF12621_consen 88 TGPPPDY 94 (95)
T ss_pred ecCCCCC
Confidence 8999998
No 4
>PF11250 DUF3049: Protein of unknown function (DUF3049); InterPro: IPR021410 This eukaryotic family of proteins has no known function.
Probab=48.54 E-value=21 Score=22.64 Aligned_cols=31 Identities=26% Similarity=0.262 Sum_probs=22.2
Q ss_pred CCCCCccccCCc----eee--eccccceeeeeeeEEE
Q psy16098 6 SGSLGVQSTAGA----VPV--LNEKGEVTMKKVKVHR 36 (99)
Q Consensus 6 ~~~~~i~STAGA----vpV--rNeKge~smqKvKV~R 36 (99)
+++|+|-|-++. +-+ ..+.|++.++.|+|..
T Consensus 2 ~fPPPl~sl~~~g~p~~~~r~~r~dGRLvl~~v~v~~ 38 (56)
T PF11250_consen 2 SFPPPLPSLARRGKPSVLMRPHREDGRLVLEEVRVPS 38 (56)
T ss_pred CCCCCCchhhcCCCCcEEEEEEccCCEEEEEEEEcCC
Confidence 567788876653 323 3589999999999854
No 5
>PF14167 YfkD: YfkD-like protein
Probab=45.93 E-value=9.9 Score=30.47 Aligned_cols=18 Identities=44% Similarity=0.643 Sum_probs=15.5
Q ss_pred ceeeeccccceeeeeeeE
Q psy16098 17 AVPVLNEKGEVTMKKVKV 34 (99)
Q Consensus 17 AvpVrNeKge~smqKvKV 34 (99)
=+|++||||++..++|=+
T Consensus 175 YaPAVnEkGkvtyGEVYl 192 (232)
T PF14167_consen 175 YAPAVNEKGKVTYGEVYL 192 (232)
T ss_pred echhhcccCceeEEEEEE
Confidence 579999999999998843
No 6
>TIGR03678 het_cyc_patell bacteriocin leader peptide, microcyclamide/patellamide family. This model represents a conserved N-terminal region shared by microcyclamide and patellamide bacteriocins precursors. These bacteriocin precursors are associated with heterocyclization.
Probab=43.95 E-value=11 Score=22.06 Aligned_cols=20 Identities=30% Similarity=0.248 Sum_probs=12.9
Q ss_pred CCCCCCCCC-Cccc-cCCceee
Q psy16098 1 MNNYSSGSL-GVQS-TAGAVPV 20 (99)
Q Consensus 1 ~~~~~~~~~-~i~S-TAGAvpV 20 (99)
++||.+.+. ||+- |||-+|.
T Consensus 3 ~~NllPqQ~~Pi~R~taGqLp~ 24 (34)
T TIGR03678 3 KKNILPQQGAPVIRGTAGKLPS 24 (34)
T ss_pred ccccCcccCCCeeecccccCcH
Confidence 478766443 5554 8887775
No 7
>PF00571 CBS: CBS domain CBS domain web page. Mutations in the CBS domain of Swiss:P35520 lead to homocystinuria.; InterPro: IPR000644 CBS (cystathionine-beta-synthase) domains are small intracellular modules, mostly found in two or four copies within a protein, that occur in a variety of proteins in bacteria, archaea, and eukaryotes [, ]. Tandem pairs of CBS domains can act as binding domains for adenosine derivatives and may regulate the activity of attached enzymatic or other domains []. In some cases, CBS domains may act as sensors of cellular energy status by being activated by AMP and inhibited by ATP []. In chloride ion channels, the CBS domains have been implicated in intracellular targeting and trafficking, as well as in protein-protein interactions, but results vary with different channels: in the CLC-5 channel, the CBS domain was shown to be required for trafficking [], while in the CLC-1 channel, the CBS domain was shown to be critical for channel function, but not necessary for trafficking []. Recent experiments revealing that CBS domains can bind adenosine-containing ligands such ATP, AMP, or S-adenosylmethionine have led to the hypothesis that CBS domains function as sensors of intracellular metabolites [, ]. Crystallographic studies of CBS domains have shown that pairs of CBS sequences form a globular domain where each CBS unit adopts a beta-alpha-beta-beta-alpha pattern []. Crystal structure of the CBS domains of the AMP-activated protein kinase in complexes with AMP and ATP shows that the phosphate groups of AMP/ATP lie in a surface pocket at the interface of two CBS domains, which is lined with basic residues, many of which are associated with disease-causing mutations []. In humans, mutations in conserved residues within CBS domains cause a variety of human hereditary diseases, including (with the gene mutated in parentheses): homocystinuria (cystathionine beta-synthase); Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase); retinitis pigmentosa (IMP dehydrogenase-1); congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members).; GO: 0005515 protein binding; PDB: 3JTF_A 3TE5_C 3TDH_C 3T4N_C 2QLV_C 3OI8_A 3LV9_A 2QH1_B 1PVM_B 3LQN_A ....
Probab=26.63 E-value=46 Score=18.65 Aligned_cols=13 Identities=31% Similarity=0.756 Sum_probs=10.7
Q ss_pred CCceeeeccccce
Q psy16098 15 AGAVPVLNEKGEV 27 (99)
Q Consensus 15 AGAvpVrNeKge~ 27 (99)
.+.+||.|++|++
T Consensus 30 ~~~~~V~d~~~~~ 42 (57)
T PF00571_consen 30 ISRLPVVDEDGKL 42 (57)
T ss_dssp SSEEEEESTTSBE
T ss_pred CcEEEEEecCCEE
Confidence 4589999999775
No 8
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism]
Probab=25.96 E-value=46 Score=28.40 Aligned_cols=21 Identities=33% Similarity=0.678 Sum_probs=18.0
Q ss_pred cCCceeeeccccceeeeeeeE
Q psy16098 14 TAGAVPVLNEKGEVTMKKVKV 34 (99)
Q Consensus 14 TAGAvpVrNeKge~smqKvKV 34 (99)
--|+|||.||.--++...+|+
T Consensus 128 ~~gvVPIINENDtva~~Eikf 148 (369)
T COG0263 128 ELGVVPIINENDTVATEEIKF 148 (369)
T ss_pred HCCceeeecCCCceeeeeeee
Confidence 358999999999999888864
No 9
>PF15650 Tox-REase-9: Restriction endonuclease fold toxin 9
Probab=21.14 E-value=46 Score=23.23 Aligned_cols=17 Identities=47% Similarity=0.612 Sum_probs=12.1
Q ss_pred eeEEEeecCCCCCCCCC
Q psy16098 32 VKVHRYVSGKRPDYAQG 48 (99)
Q Consensus 32 vKV~RYv~GKrPdyA~~ 48 (99)
.|=-|-.+|||||+-.-
T Consensus 28 ~kEf~lpsGkR~D~id~ 44 (89)
T PF15650_consen 28 EKEFRLPSGKRPDFIDF 44 (89)
T ss_pred eeeeecCCCCcCccccC
Confidence 34456679999997653
No 10
>PF15266 DUF4594: Domain of unknown function (DUF4594)
Probab=18.50 E-value=55 Score=25.34 Aligned_cols=9 Identities=44% Similarity=0.966 Sum_probs=7.3
Q ss_pred HHHHhhhcC
Q psy16098 91 EEDRRSRHR 99 (99)
Q Consensus 91 e~er~~rhr 99 (99)
+.+||||||
T Consensus 78 D~eRlaRhR 86 (182)
T PF15266_consen 78 DQERLARHR 86 (182)
T ss_pred hHHHHHhhc
Confidence 458999997
Done!