Query         psy16098
Match_columns 99
No_of_seqs    77 out of 79
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 20:48:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16098.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16098hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1425|consensus               99.9   6E-26 1.3E-30  187.5   3.3   86    8-99      5-98  (430)
  2 PF09151 DUF1936:  Domain of un  78.4     1.3 2.9E-05   26.0   1.3   12   17-28     12-23  (36)
  3 PF12621 DUF3779:  Phosphate me  49.6      14  0.0003   25.0   2.0    7   39-45     88-94  (95)
  4 PF11250 DUF3049:  Protein of u  48.5      21 0.00045   22.6   2.5   31    6-36      2-38  (56)
  5 PF14167 YfkD:  YfkD-like prote  45.9     9.9 0.00021   30.5   0.9   18   17-34    175-192 (232)
  6 TIGR03678 het_cyc_patell bacte  44.0      11 0.00024   22.1   0.7   20    1-20      3-24  (34)
  7 PF00571 CBS:  CBS domain CBS d  26.6      46   0.001   18.7   1.4   13   15-27     30-42  (57)
  8 COG0263 ProB Glutamate 5-kinas  26.0      46 0.00099   28.4   1.8   21   14-34    128-148 (369)
  9 PF15650 Tox-REase-9:  Restrict  21.1      46 0.00099   23.2   0.8   17   32-48     28-44  (89)
 10 PF15266 DUF4594:  Domain of un  18.5      55  0.0012   25.3   0.8    9   91-99     78-86  (182)

No 1  
>KOG1425|consensus
Probab=99.92  E-value=6e-26  Score=187.50  Aligned_cols=86  Identities=51%  Similarity=0.791  Sum_probs=75.2

Q ss_pred             CCCccccCCceeeeccccceeeeeeeEEEeecCCCCCCCCCCCCCCcchhHHhhhccccCCCCCC------CCCChHHHH
Q psy16098          8 SLGVQSTAGAVPVLNEKGEVTMKKVKVHRYVSGKRPDYAQGSSDSEDDDDEVVNRKSEFTSIPHI------PFEDPRLRR   81 (99)
Q Consensus         8 ~~~i~STAGAvpVrNeKge~smqKvKV~RYv~GKrPdyA~~~~sdede~~~fi~k~~~~~~~~~~------~~~DpRLRR   81 (99)
                      .++|||   ||||+ +||+++||||||+|||+||+|+||+  ||++|++++|++.++....+|++      ..+||||||
T Consensus         5 ~~~~~s---aipvr-ekg~~~m~kvkv~ryv~gk~peya~--sseed~d~~~~~~~~~~~a~~ee~~~~~~~~ddprlrr   78 (430)
T KOG1425|consen    5 ASVIQS---AIPVR-EKGEGSMQKVKVRRYVSGKAPEYAR--SSEEDDDVDFIKDRKRDRAEPEEDEEDVARIDDPRLRR   78 (430)
T ss_pred             cccccc---ccchh-hhcccccceeeeeeecCCCCccccc--ccccchhhhHHHHHHHHhcCcchhhcccccccCccccc
Confidence            567888   99999 9999999999999999999999999  55558888999998876666654      688999999


Q ss_pred             hhhhc--chhhHHHHhhhcC
Q psy16098         82 LTSRK--QEDAEEDRRSRHR   99 (99)
Q Consensus        82 L~~r~--~~d~e~er~~rhr   99 (99)
                      |+.+.  .+++|.++.++||
T Consensus        79 l~~~~~~~e~~E~e~~e~hr   98 (430)
T KOG1425|consen   79 LPQRPVRSEDVEGERSERHR   98 (430)
T ss_pred             ccccccccchhhhhhhhhhh
Confidence            99986  5899988898886


No 2  
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=78.44  E-value=1.3  Score=26.01  Aligned_cols=12  Identities=50%  Similarity=0.833  Sum_probs=8.8

Q ss_pred             ceeeecccccee
Q psy16098         17 AVPVLNEKGEVT   28 (99)
Q Consensus        17 AvpVrNeKge~s   28 (99)
                      -+||-|+||+|+
T Consensus        12 l~pvy~~kgeik   23 (36)
T PF09151_consen   12 LEPVYNQKGEIK   23 (36)
T ss_dssp             EEEEE-TTS-EE
T ss_pred             EEEeecCCCcEE
Confidence            689999999984


No 3  
>PF12621 DUF3779:  Phosphate metabolism protein ;  InterPro: IPR022257  This domain family is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with PF02714 from PFAM. There are two completely conserved residues (W and D) that may be functionally important. This family is likely to be involved in phosphate metabolism however there is little accompanying literature to confirm this. 
Probab=49.64  E-value=14  Score=24.95  Aligned_cols=7  Identities=57%  Similarity=1.270  Sum_probs=6.5

Q ss_pred             cCCCCCC
Q psy16098         39 SGKRPDY   45 (99)
Q Consensus        39 ~GKrPdy   45 (99)
                      .|..|||
T Consensus        88 ~~~PPd~   94 (95)
T PF12621_consen   88 TGPPPDY   94 (95)
T ss_pred             ecCCCCC
Confidence            8999998


No 4  
>PF11250 DUF3049:  Protein of unknown function (DUF3049);  InterPro: IPR021410  This eukaryotic family of proteins has no known function. 
Probab=48.54  E-value=21  Score=22.64  Aligned_cols=31  Identities=26%  Similarity=0.262  Sum_probs=22.2

Q ss_pred             CCCCCccccCCc----eee--eccccceeeeeeeEEE
Q psy16098          6 SGSLGVQSTAGA----VPV--LNEKGEVTMKKVKVHR   36 (99)
Q Consensus         6 ~~~~~i~STAGA----vpV--rNeKge~smqKvKV~R   36 (99)
                      +++|+|-|-++.    +-+  ..+.|++.++.|+|..
T Consensus         2 ~fPPPl~sl~~~g~p~~~~r~~r~dGRLvl~~v~v~~   38 (56)
T PF11250_consen    2 SFPPPLPSLARRGKPSVLMRPHREDGRLVLEEVRVPS   38 (56)
T ss_pred             CCCCCCchhhcCCCCcEEEEEEccCCEEEEEEEEcCC
Confidence            567788876653    323  3589999999999854


No 5  
>PF14167 YfkD:  YfkD-like protein
Probab=45.93  E-value=9.9  Score=30.47  Aligned_cols=18  Identities=44%  Similarity=0.643  Sum_probs=15.5

Q ss_pred             ceeeeccccceeeeeeeE
Q psy16098         17 AVPVLNEKGEVTMKKVKV   34 (99)
Q Consensus        17 AvpVrNeKge~smqKvKV   34 (99)
                      =+|++||||++..++|=+
T Consensus       175 YaPAVnEkGkvtyGEVYl  192 (232)
T PF14167_consen  175 YAPAVNEKGKVTYGEVYL  192 (232)
T ss_pred             echhhcccCceeEEEEEE
Confidence            579999999999998843


No 6  
>TIGR03678 het_cyc_patell bacteriocin leader peptide, microcyclamide/patellamide family. This model represents a conserved N-terminal region shared by microcyclamide and patellamide bacteriocins precursors. These bacteriocin precursors are associated with heterocyclization.
Probab=43.95  E-value=11  Score=22.06  Aligned_cols=20  Identities=30%  Similarity=0.248  Sum_probs=12.9

Q ss_pred             CCCCCCCCC-Cccc-cCCceee
Q psy16098          1 MNNYSSGSL-GVQS-TAGAVPV   20 (99)
Q Consensus         1 ~~~~~~~~~-~i~S-TAGAvpV   20 (99)
                      ++||.+.+. ||+- |||-+|.
T Consensus         3 ~~NllPqQ~~Pi~R~taGqLp~   24 (34)
T TIGR03678         3 KKNILPQQGAPVIRGTAGKLPS   24 (34)
T ss_pred             ccccCcccCCCeeecccccCcH
Confidence            478766443 5554 8887775


No 7  
>PF00571 CBS:  CBS domain CBS domain web page. Mutations in the CBS domain of Swiss:P35520 lead to homocystinuria.;  InterPro: IPR000644 CBS (cystathionine-beta-synthase) domains are small intracellular modules, mostly found in two or four copies within a protein, that occur in a variety of proteins in bacteria, archaea, and eukaryotes [, ]. Tandem pairs of CBS domains can act as binding domains for adenosine derivatives and may regulate the activity of attached enzymatic or other domains []. In some cases, CBS domains may act as sensors of cellular energy status by being activated by AMP and inhibited by ATP []. In chloride ion channels, the CBS domains have been implicated in intracellular targeting and trafficking, as well as in protein-protein interactions, but results vary with different channels: in the CLC-5 channel, the CBS domain was shown to be required for trafficking [], while in the CLC-1 channel, the CBS domain was shown to be critical for channel function, but not necessary for trafficking []. Recent experiments revealing that CBS domains can bind adenosine-containing ligands such ATP, AMP, or S-adenosylmethionine have led to the hypothesis that CBS domains function as sensors of intracellular metabolites [, ]. Crystallographic studies of CBS domains have shown that pairs of CBS sequences form a globular domain where each CBS unit adopts a beta-alpha-beta-beta-alpha pattern []. Crystal structure of the CBS domains of the AMP-activated protein kinase in complexes with AMP and ATP shows that the phosphate groups of AMP/ATP lie in a surface pocket at the interface of two CBS domains, which is lined with basic residues, many of which are associated with disease-causing mutations [].  In humans, mutations in conserved residues within CBS domains cause a variety of human hereditary diseases, including (with the gene mutated in parentheses): homocystinuria (cystathionine beta-synthase); Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase); retinitis pigmentosa (IMP dehydrogenase-1); congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members).; GO: 0005515 protein binding; PDB: 3JTF_A 3TE5_C 3TDH_C 3T4N_C 2QLV_C 3OI8_A 3LV9_A 2QH1_B 1PVM_B 3LQN_A ....
Probab=26.63  E-value=46  Score=18.65  Aligned_cols=13  Identities=31%  Similarity=0.756  Sum_probs=10.7

Q ss_pred             CCceeeeccccce
Q psy16098         15 AGAVPVLNEKGEV   27 (99)
Q Consensus        15 AGAvpVrNeKge~   27 (99)
                      .+.+||.|++|++
T Consensus        30 ~~~~~V~d~~~~~   42 (57)
T PF00571_consen   30 ISRLPVVDEDGKL   42 (57)
T ss_dssp             SSEEEEESTTSBE
T ss_pred             CcEEEEEecCCEE
Confidence            4589999999775


No 8  
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism]
Probab=25.96  E-value=46  Score=28.40  Aligned_cols=21  Identities=33%  Similarity=0.678  Sum_probs=18.0

Q ss_pred             cCCceeeeccccceeeeeeeE
Q psy16098         14 TAGAVPVLNEKGEVTMKKVKV   34 (99)
Q Consensus        14 TAGAvpVrNeKge~smqKvKV   34 (99)
                      --|+|||.||.--++...+|+
T Consensus       128 ~~gvVPIINENDtva~~Eikf  148 (369)
T COG0263         128 ELGVVPIINENDTVATEEIKF  148 (369)
T ss_pred             HCCceeeecCCCceeeeeeee
Confidence            358999999999999888864


No 9  
>PF15650 Tox-REase-9:  Restriction endonuclease fold toxin 9
Probab=21.14  E-value=46  Score=23.23  Aligned_cols=17  Identities=47%  Similarity=0.612  Sum_probs=12.1

Q ss_pred             eeEEEeecCCCCCCCCC
Q psy16098         32 VKVHRYVSGKRPDYAQG   48 (99)
Q Consensus        32 vKV~RYv~GKrPdyA~~   48 (99)
                      .|=-|-.+|||||+-.-
T Consensus        28 ~kEf~lpsGkR~D~id~   44 (89)
T PF15650_consen   28 EKEFRLPSGKRPDFIDF   44 (89)
T ss_pred             eeeeecCCCCcCccccC
Confidence            34456679999997653


No 10 
>PF15266 DUF4594:  Domain of unknown function (DUF4594)
Probab=18.50  E-value=55  Score=25.34  Aligned_cols=9  Identities=44%  Similarity=0.966  Sum_probs=7.3

Q ss_pred             HHHHhhhcC
Q psy16098         91 EEDRRSRHR   99 (99)
Q Consensus        91 e~er~~rhr   99 (99)
                      +.+||||||
T Consensus        78 D~eRlaRhR   86 (182)
T PF15266_consen   78 DQERLARHR   86 (182)
T ss_pred             hHHHHHhhc
Confidence            458999997


Done!