Diaphorina citri psyllid: psy16098


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MNNYSSGSLGVQSTAGAVPVLNEKGEVTMKKVKVHRYVSGKRPDYAQGSSDSEDDDDEVVNRKSEFTSIPHIPFEDPRLRRLTSRKQEDAEEDRRSRHR
cccccccccccccccccccEEcccccEEEEEEEEEEEEcccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHcccccHHHHHHHHcc
*******************VLNEKGEVTMKKVKVHRYVSGKR*********************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNYSSGSLGVQSTAGAVPVLNEKGEVTMKKVKVHRYVSGKRPDYAQGSSDSEDDDDEVVNRKSEFTSIPHIPFEDPRLRRLTSRKQEDAEEDRRSRHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microfibrillar-associated protein 1 Component of the elastin-associated microfibrils.confidentP55081
Microfibrillar-associated protein 1 Component of the elastin-associated microfibrils.confidentQ9CQU1
Microfibrillar-associated protein 1 Component of the elastin-associated microfibrils.confidentQ5EA98

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0001527 [CC]microfibrilprobableGO:0043205, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted