Query         psy16163
Match_columns 85
No_of_seqs    131 out of 208
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:24:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16163.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16163hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1700|consensus               97.8 8.9E-06 1.9E-10   60.1   1.2   35    2-37     42-76  (200)
  2 PF00412 LIM:  LIM domain;  Int  95.6  0.0032   7E-08   36.3   0.1   25    2-27     34-58  (58)
  3 KOG1700|consensus               94.7   0.014   3E-07   43.2   1.1   35    2-36    143-177 (200)
  4 COG0723 QcrA Rieske Fe-S prote  55.5     6.8 0.00015   27.7   1.3   20   11-32    121-140 (177)
  5 KOG4239|consensus               53.9       3 6.5E-05   34.2  -0.9   26   55-80     39-64  (348)
  6 KOG1703|consensus               53.5       5 0.00011   32.9   0.4   28    2-30    397-424 (479)
  7 COG0194 Gmk Guanylate kinase [  45.9      23 0.00049   26.8   2.8   47   13-67      3-65  (191)
  8 KOG4440|consensus               43.5      15 0.00033   33.3   1.7   37   17-63    754-790 (993)
  9 PF10281 Ish1:  Putative stress  38.5      37  0.0008   18.6   2.3   18   51-68     19-37  (38)
 10 PF07967 zf-C3HC:  C3HC zinc fi  32.5      30 0.00065   23.5   1.5   16   56-71      2-17  (133)
 11 TIGR01416 Rieske_proteo ubiqui  32.4      28 0.00061   25.1   1.4   17   13-31    131-147 (174)
 12 PF00355 Rieske:  Rieske [2Fe-2  31.4      28  0.0006   21.4   1.1   20   13-34     59-79  (97)
 13 PF07526 POX:  Associated with   31.4      15 0.00033   26.0  -0.1   17   58-74     79-99  (140)
 14 PF09373 PMBR:  Pseudomurein-bi  30.2      22 0.00048   19.2   0.4   20   54-73      3-22  (33)
 15 PF11918 DUF3436:  Domain of un  29.7      62  0.0013   20.2   2.4   18   50-67     32-49  (55)
 16 cd03470 Rieske_cytochrome_bc1   29.0      35 0.00077   23.4   1.4   18   13-32     83-100 (126)
 17 PF08846 DUF1816:  Domain of un  28.4      36 0.00077   21.9   1.2   19   52-70     25-43  (68)
 18 smart00574 POX domain associat  28.1      19 0.00041   26.2  -0.1   18   58-75     79-100 (140)
 19 PF08586 Rsc14:  RSC complex, R  27.1      38 0.00082   23.5   1.3   14   51-64     82-95  (101)
 20 KOG1432|consensus               26.8      42  0.0009   28.0   1.7   24   10-36    315-338 (379)
 21 KOG1044|consensus               23.6      26 0.00057   31.0  -0.0   24    7-31    172-195 (670)
 22 cd03469 Rieske_RO_Alpha_N Ries  22.1      60  0.0013   20.6   1.5   19   12-32     57-75  (118)
 23 PF07627 PSCyt3:  Protein of un  21.5      17 0.00037   24.6  -1.3   25   10-36     64-88  (101)
 24 TIGR01213 conserved hypothetic  21.4      32  0.0007   28.5   0.1   20   15-35      8-27  (388)
 25 PHA03010 hypothetical protein;  21.3      42 0.00091   28.7   0.7   18   65-82    382-399 (546)

No 1  
>KOG1700|consensus
Probab=97.77  E-value=8.9e-06  Score=60.06  Aligned_cols=35  Identities=40%  Similarity=0.635  Sum_probs=33.0

Q ss_pred             ccccccccceecCeeeecCCccccccCCccccCCcc
Q psy16163          2 TVTNTSVTYTHKGVPYCHVPCYGALFGPQLFGHGTR   37 (85)
Q Consensus         2 K~Ldsg~~aehdgk~YC~k~CY~klFGPkG~G~G~~   37 (85)
                      |+|+++++++|++++|| +.||.+.|||+|+|++.+
T Consensus        42 k~l~~~~~~~~e~~~yc-~~~~~~~~~~~~~~~~~~   76 (200)
T KOG1700|consen   42 KTLTLSGYSEHEGVPYC-KNCHVAQFGPKGGGFGKG   76 (200)
T ss_pred             ccccccccccccccccc-ccchHhhhCccccccccc
Confidence            78999999999999999 699999999999999974


No 2  
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=95.64  E-value=0.0032  Score=36.33  Aligned_cols=25  Identities=36%  Similarity=0.760  Sum_probs=21.8

Q ss_pred             ccccccccceecCeeeecCCcccccc
Q psy16163          2 TVTNTSVTYTHKGVPYCHVPCYGALF   27 (85)
Q Consensus         2 K~Ldsg~~aehdgk~YC~k~CY~klF   27 (85)
                      +.|.++.+.+.+++||| +.||.++|
T Consensus        34 ~~l~~~~~~~~~~~~~C-~~c~~~~f   58 (58)
T PF00412_consen   34 KPLNDGDFYEKDGKPYC-KDCYQKRF   58 (58)
T ss_dssp             CBTTTSSEEEETTEEEE-HHHHHHHT
T ss_pred             CccCCCeeEeECCEEEC-HHHHhhhC
Confidence            46778889999999999 69999987


No 3  
>KOG1700|consensus
Probab=94.71  E-value=0.014  Score=43.19  Aligned_cols=35  Identities=17%  Similarity=0.212  Sum_probs=32.4

Q ss_pred             ccccccccceecCeeeecCCccccccCCccccCCc
Q psy16163          2 TVTNTSVTYTHKGVPYCHVPCYGALFGPQLFGHGT   36 (85)
Q Consensus         2 K~Ldsg~~aehdgk~YC~k~CY~klFGPkG~G~G~   36 (85)
                      +.|++++.+++++.+||.+.|++.++|+.+++.+.
T Consensus       143 ~~ls~~~~~~~~g~l~~~~~~~~~~~~~~~~~~~~  177 (200)
T KOG1700|consen  143 KKLSPKNYAALEGVLYCKHHFAQLFKGKGNYNEGF  177 (200)
T ss_pred             cccCCcchhhcCCccccchhhheeecCCCcccccc
Confidence            57999999999999999889999999999998875


No 4  
>COG0723 QcrA Rieske Fe-S protein [Energy production and conversion]
Probab=55.49  E-value=6.8  Score=27.65  Aligned_cols=20  Identities=30%  Similarity=0.698  Sum_probs=17.5

Q ss_pred             eecCeeeecCCccccccCCccc
Q psy16163         11 THKGVPYCHVPCYGALFGPQLF   32 (85)
Q Consensus        11 ehdgk~YC~k~CY~klFGPkG~   32 (85)
                      ..++.++|  +||+..|-|.|.
T Consensus       121 ~~~~~~~C--PCHGS~yd~~g~  140 (177)
T COG0723         121 GAEGGFFC--PCHGSRYDPDGG  140 (177)
T ss_pred             CCCCeEEc--cCCCCeEcCCCC
Confidence            45688999  899999999985


No 5  
>KOG4239|consensus
Probab=53.88  E-value=3  Score=34.17  Aligned_cols=26  Identities=19%  Similarity=0.006  Sum_probs=23.2

Q ss_pred             CCChhHHHHHhhhhheeeeCccceeE
Q psy16163         55 NMPRSHLESKLNLYNQYYDGKSGEIR   80 (85)
Q Consensus        55 ~i~r~~l~s~LktYN~y~e~k~~~i~   80 (85)
                      .|...++|=.+|+||+|+++.+++.+
T Consensus        39 ~~~p~~~lv~~r~~~~~~~g~~~~~~   64 (348)
T KOG4239|consen   39 HIQPLELLVPLRGHNFYTAGLLLPTW   64 (348)
T ss_pred             ccCcccceeecccccccccccccccc
Confidence            66778888889999999999999988


No 6  
>KOG1703|consensus
Probab=53.55  E-value=5  Score=32.89  Aligned_cols=28  Identities=29%  Similarity=0.573  Sum_probs=24.2

Q ss_pred             ccccccccceecCeeeecCCccccccCCc
Q psy16163          2 TVTNTSVTYTHKGVPYCHVPCYGALFGPQ   30 (85)
Q Consensus         2 K~Ldsg~~aehdgk~YC~k~CY~klFGPk   30 (85)
                      +.|.+..+-+++++||| ..||-++|+++
T Consensus       397 ~~~~~~~~~~~~~~pyc-e~~~~~~~~~~  424 (479)
T KOG1703|consen  397 KPLKNSSFFESDGEPYC-EDHYKKLFTTK  424 (479)
T ss_pred             CCCCCCcccccCCccch-hhhHhhhcccc
Confidence            56778888999999999 59999999955


No 7  
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=45.92  E-value=23  Score=26.80  Aligned_cols=47  Identities=21%  Similarity=0.137  Sum_probs=32.7

Q ss_pred             cCeeeecCCccccccCCccccCCc------------cceeeeecccccc----CCCCCCCChhHHHHHhhh
Q psy16163         13 KGVPYCHVPCYGALFGPQLFGHGT------------RVESHTSFGKVEN----KPCGSNMPRSHLESKLNL   67 (85)
Q Consensus        13 dgk~YC~k~CY~klFGPkG~G~G~------------~~~sh~~~~~~~~----~~~~~~i~r~~l~s~Lkt   67 (85)
                      .|.++|       +.||.|.|=++            -+.|||+..+-..    +-|. +|++.+|+++++.
T Consensus         3 ~G~l~v-------lsgPSG~GKsTl~k~L~~~~~l~~SVS~TTR~pR~gEv~G~dY~-Fvs~~EF~~~i~~   65 (191)
T COG0194           3 KGLLIV-------LSGPSGVGKSTLVKALLEDDKLRFSVSATTRKPRPGEVDGVDYF-FVTEEEFEELIER   65 (191)
T ss_pred             CceEEE-------EECCCCCCHHHHHHHHHhhcCeEEEEEeccCCCCCCCcCCceeE-eCCHHHHHHHHhc
Confidence            456666       68999988774            3567776655322    3333 8999999999874


No 8  
>KOG4440|consensus
Probab=43.52  E-value=15  Score=33.31  Aligned_cols=37  Identities=30%  Similarity=0.529  Sum_probs=28.6

Q ss_pred             eecCCccccccCCccccCCccceeeeeccccccCCCCCCCChhHHHH
Q psy16163         17 YCHVPCYGALFGPQLFGHGTRVESHTSFGKVENKPCGSNMPRSHLES   63 (85)
Q Consensus        17 YC~k~CY~klFGPkG~G~G~~~~sh~~~~~~~~~~~~~~i~r~~l~s   63 (85)
                      -|.-.--+.|||-.|||.|-          +.+.||-++|+=+=|.+
T Consensus       754 ~CeLvT~GeLFgRSgyGIGl----------qK~SPWt~~vtlaIL~~  790 (993)
T KOG4440|consen  754 KCELVTTGELFGRSGYGIGL----------QKDSPWTQNVTLAILKS  790 (993)
T ss_pred             ccceEecccccccccccccc----------ccCCCCcchhhHHHHHh
Confidence            35444568899999999997          78899998887655543


No 9  
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=38.47  E-value=37  Score=18.58  Aligned_cols=18  Identities=17%  Similarity=0.137  Sum_probs=12.3

Q ss_pred             CCCCCC-ChhHHHHHhhhh
Q psy16163         51 PCGSNM-PRSHLESKLNLY   68 (85)
Q Consensus        51 ~~~~~i-~r~~l~s~LktY   68 (85)
                      |..... +|++|+.++|.+
T Consensus        19 ~~~~~~~~rd~Ll~~~k~~   37 (38)
T PF10281_consen   19 PVPKSAKTRDELLKLAKKN   37 (38)
T ss_pred             CCCCCCCCHHHHHHHHHHh
Confidence            333444 899999888754


No 10 
>PF07967 zf-C3HC:  C3HC zinc finger-like ;  InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc-finger like domain is distributed throughout the eukaryotic kingdom in NIPA (Nuclear interacting partner of ALK) and other proteins. NIPA is thought to perform an antiapoptotic role in nucleophosmin-anaplastic lymphoma kinase (ALK) mediated signalling events []. The domain is often repeated, with the second domain usually containing a large insert (approximately 90 residues) after the first three cysteine residues. The Schizosaccharomyces pombe protein containing this domain (O94506 from SWISSPROT) is involved in mRNA export from the nucleus [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=32.45  E-value=30  Score=23.50  Aligned_cols=16  Identities=13%  Similarity=0.314  Sum_probs=14.0

Q ss_pred             CChhHHHHHhhhhhee
Q psy16163         56 MPRSHLESKLNLYNQY   71 (85)
Q Consensus        56 i~r~~l~s~LktYN~y   71 (85)
                      -+|.+|+..|+||+..
T Consensus         2 ~~r~~~l~RL~Tf~~~   17 (133)
T PF07967_consen    2 WDREDFLRRLETFKSL   17 (133)
T ss_pred             CCHHHHHHHHHHcccc
Confidence            3699999999999974


No 11 
>TIGR01416 Rieske_proteo ubiquinol-cytochrome c reductase, iron-sulfur subunit. Most members of this family have a recognizable twin-arginine translocation (tat) signal sequence (DeltaPh-dependent translocation in chloroplast) for transport across the membrane with the 2Fe-2S group already bound. These signal sequences include a motif resembling RRxFLK before the transmembrane helix.
Probab=32.41  E-value=28  Score=25.12  Aligned_cols=17  Identities=35%  Similarity=0.837  Sum_probs=14.5

Q ss_pred             cCeeeecCCccccccCCcc
Q psy16163         13 KGVPYCHVPCYGALFGPQL   31 (85)
Q Consensus        13 dgk~YC~k~CY~klFGPkG   31 (85)
                      .+.++|  +||+..|.+.|
T Consensus       131 ~~~~~C--PcHgs~Fd~~G  147 (174)
T TIGR01416       131 KGGFFC--PCHGSHYDTAG  147 (174)
T ss_pred             CCEEEe--CCCCCEECCCC
Confidence            356999  89999999975


No 12 
>PF00355 Rieske:  Rieske [2Fe-2S] domain;  InterPro: IPR017941 There are multiple types of iron-sulphur clusters which are grouped into three main categories based on their atomic content: [2Fe-2S], [3Fe-4S], [4Fe-4S] (see PDOC00176 from PROSITEDOC), and other hybrid or mixed metal types. Two general types of [2Fe-2S] clusters are known and they differ in their coordinating residues. The ferredoxin-type [2Fe-2S] clusters are coordinated to the protein by four cysteine residues (see PDOC00175 from PROSITEDOC). The Rieske-type [2Fe-2S] cluster is coordinated to its protein by two cysteine residues and two histidine residues [, ]. The structure of several Rieske domains has been solved []. It contains three layers of antiparallel beta sheets forming two beta sandwiches. Both beta sandwiches share the central sheet 2. The metal-binding site is at the top of the beta sandwich formed by the sheets 2 and 3. The Fe1 iron of the Rieske cluster is coordinated by two cysteines while the other iron Fe2 is coordinated by two histidines. Two inorganic sulphide ions bridge the two iron ions forming a flat, rhombic cluster.  Rieske-type iron-sulphur clusters are common to electron transfer chains of mitochondria and chloroplast and to non-haem iron oxygenase systems:   The Rieske protein of the Ubiquinol-cytochrome c reductase (1.10.2.2 from EC) (also known as the bc1 complex or complex III), a complex of the electron transport chains of mitochondria and of some aerobic prokaryotes; it catalyses the oxidoreduction of ubiquinol and cytochrome c.  The Rieske protein of chloroplastic plastoquinone-plastocyanin reductase (1.10.99.1 from EC) (also known as the b6f complex). It is functionally similar to the bc1 complex and catalyses the oxidoreduction of plastoquinol and cytochrome f.  Bacterial naphthalene 1,2-dioxygenase subunit alpha, a component of the naphthalene dioxygenase (NDO) multicomponent enzyme system which catalyses the incorporation of both atoms of molecular oxygen into naphthalene to form cis-naphthalene dihydrodiol.  Bacterial 3-phenylpropionate dioxygenase ferredoxin subunit.  Bacterial toluene monoxygenase.  Bacterial biphenyl dioxygenase. ; GO: 0016491 oxidoreductase activity, 0051537 2 iron, 2 sulfur cluster binding, 0055114 oxidation-reduction process; PDB: 2XRX_A 2XR8_O 2XSH_G 2XSO_I 2YFI_C 2YFL_A 2YFJ_K 1G8J_D 1G8K_D 1NYK_B ....
Probab=31.44  E-value=28  Score=21.44  Aligned_cols=20  Identities=35%  Similarity=0.464  Sum_probs=16.4

Q ss_pred             cCeeeecCCccccccCCc-cccC
Q psy16163         13 KGVPYCHVPCYGALFGPQ-LFGH   34 (85)
Q Consensus        13 dgk~YC~k~CY~klFGPk-G~G~   34 (85)
                      ++.+.|  +|++..|.+. |--.
T Consensus        59 ~~~i~C--p~Hg~~Fd~~tG~~~   79 (97)
T PF00355_consen   59 GGVIVC--PCHGWRFDLDTGECV   79 (97)
T ss_dssp             TTEEEE--TTTTEEEETTTSBEE
T ss_pred             cCEEEe--CCcCCEEeCCCceEe
Confidence            578999  8999999999 6433


No 13 
>PF07526 POX:  Associated with HOX;  InterPro: IPR006563 This domain in found exclusively in plant proteins, associated with HOX domains which may suggest these proteins are homeodomain transcription factors.
Probab=31.35  E-value=15  Score=26.00  Aligned_cols=17  Identities=47%  Similarity=0.757  Sum_probs=13.8

Q ss_pred             hhHHHHHh----hhhheeeeC
Q psy16163         58 RSHLESKL----NLYNQYYDG   74 (85)
Q Consensus        58 r~~l~s~L----ktYN~y~e~   74 (85)
                      |+.|+++|    +.||+||++
T Consensus        79 K~KLl~mL~eVd~RY~qY~~Q   99 (140)
T PF07526_consen   79 KAKLLSMLDEVDRRYRQYYDQ   99 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            67788888    579999975


No 14 
>PF09373 PMBR:  Pseudomurein-binding repeat;  InterPro: IPR018975  Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) is a methanogenic Gram-positive microorganism with a cell wall consisting of pseudomurein. This repeat specifically binds to pseudomurein. This repeat is found at the N terminus of PeiW and PeiP which are pseudomurein binding phage proteins. 
Probab=30.22  E-value=22  Score=19.22  Aligned_cols=20  Identities=10%  Similarity=0.333  Sum_probs=18.2

Q ss_pred             CCCChhHHHHHhhhhheeee
Q psy16163         54 SNMPRSHLESKLNLYNQYYD   73 (85)
Q Consensus        54 ~~i~r~~l~s~LktYN~y~e   73 (85)
                      ..|++++++..++..+.|++
T Consensus         3 ~~i~~~~~~d~a~rv~~f~~   22 (33)
T PF09373_consen    3 GTISKEEYLDMASRVNNFYE   22 (33)
T ss_pred             ceecHHHHHHHHHHHHHHHH
Confidence            37999999999999999995


No 15 
>PF11918 DUF3436:  Domain of unknown function (DUF3436);  InterPro: IPR024591 This uncharacterised N-terminal domain is associated with the interphotoreceptor retinol-binding protein family. It is about 50 amino acids in length and has two conserved sequence motifs: DPRL and SYEP.
Probab=29.69  E-value=62  Score=20.18  Aligned_cols=18  Identities=22%  Similarity=0.265  Sum_probs=14.9

Q ss_pred             CCCCCCCChhHHHHHhhh
Q psy16163         50 KPCGSNMPRSHLESKLNL   67 (85)
Q Consensus        50 ~~~~~~i~r~~l~s~Lkt   67 (85)
                      -|--+++|.+||++.|++
T Consensus        32 ~p~~~~Lt~EqLla~lq~   49 (55)
T PF11918_consen   32 PPALPNLTPEQLLAMLQK   49 (55)
T ss_pred             CCCCCCcCHHHHHHHHHh
Confidence            455579999999999985


No 16 
>cd03470 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. The bc(1) complex is a multisubunit enzyme found in many different organisms including uni- and multi-cellular eukaryotes, plants (in their mitochondria) and bacteria. The cytochrome bc(1) and b6f complexes are central components of the respiratory and photosynthetic electron transport chains, respectively, which carry out similar core electron and proton transfer steps. The bc(1) and b6f complexes share a common core structure of three catalytic subunits: cyt b, the Rieske ISP, and either a cyt c1 in the bc(1) complex or cyt f in the b6f complex, which are arranged in an integral membrane-bound dimeric complex. While the core of the b6f complex is similar to that of the bc(1) complex, the domain arrangement outside the core and the complement of prosthetic groups are strikingly different.
Probab=28.99  E-value=35  Score=23.36  Aligned_cols=18  Identities=28%  Similarity=0.645  Sum_probs=15.1

Q ss_pred             cCeeeecCCccccccCCccc
Q psy16163         13 KGVPYCHVPCYGALFGPQLF   32 (85)
Q Consensus        13 dgk~YC~k~CY~klFGPkG~   32 (85)
                      .+.++|  +||+..|-..|-
T Consensus        83 ~~~~~C--PcHgs~Fdl~G~  100 (126)
T cd03470          83 YGGFFC--PCHGSHYDASGR  100 (126)
T ss_pred             CCEEEe--cCcCCEECCCCe
Confidence            467999  899999999753


No 17 
>PF08846 DUF1816:  Domain of unknown function (DUF1816);  InterPro: IPR014945  Q4C9H3 from SWISSPROT is associated with the IPR008213 from INTERPRO domain suggesting this protein could have a role in phycobilisomes. 
Probab=28.43  E-value=36  Score=21.85  Aligned_cols=19  Identities=26%  Similarity=0.253  Sum_probs=15.7

Q ss_pred             CCCCCChhHHHHHhhhhhe
Q psy16163         52 CGSNMPRSHLESKLNLYNQ   70 (85)
Q Consensus        52 ~~~~i~r~~l~s~LktYN~   70 (85)
                      |||+++|+++.+.+-.|=.
T Consensus        25 FGPF~s~~eA~~~~~gyie   43 (68)
T PF08846_consen   25 FGPFDSREEAEAALPGYIE   43 (68)
T ss_pred             eCCcCCHHHHHHHhccHHH
Confidence            6789999999998877643


No 18 
>smart00574 POX domain associated with HOX domains.
Probab=28.05  E-value=19  Score=26.16  Aligned_cols=18  Identities=33%  Similarity=0.634  Sum_probs=13.2

Q ss_pred             hhHHHHHh----hhhheeeeCc
Q psy16163         58 RSHLESKL----NLYNQYYDGK   75 (85)
Q Consensus        58 r~~l~s~L----ktYN~y~e~k   75 (85)
                      |+.|+++|    +.||+||++=
T Consensus        79 k~kLl~mL~eVd~RY~qY~~qm  100 (140)
T smart00574       79 KAKLLSMLEEVDRRYKHYYEQM  100 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            34577777    6899999763


No 19 
>PF08586 Rsc14:  RSC complex, Rsc14/Ldb7 subunit;  InterPro: IPR013895  RSC is an ATP-dependent chromatin remodelling complex found in yeast. The RSC components Rsc7/Npl6 and Rsc14/Ldb7 interact physically and/or functionally with Rsc3, Rsc30, and Htl1 to form a module important for a broad range of RSC functions []. 
Probab=27.14  E-value=38  Score=23.50  Aligned_cols=14  Identities=43%  Similarity=0.591  Sum_probs=11.9

Q ss_pred             CCCCCCChhHHHHH
Q psy16163         51 PCGSNMPRSHLESK   64 (85)
Q Consensus        51 ~~~~~i~r~~l~s~   64 (85)
                      =.|..+||.+|+||
T Consensus        82 LLGgyVPr~QLEsL   95 (101)
T PF08586_consen   82 LLGGYVPRQQLESL   95 (101)
T ss_pred             cccCcCCHHHHHhh
Confidence            35789999999997


No 20 
>KOG1432|consensus
Probab=26.84  E-value=42  Score=28.01  Aligned_cols=24  Identities=33%  Similarity=0.487  Sum_probs=18.4

Q ss_pred             ceecCeeeecCCccccccCCccccCCc
Q psy16163         10 YTHKGVPYCHVPCYGALFGPQLFGHGT   36 (85)
Q Consensus        10 aehdgk~YC~k~CY~klFGPkG~G~G~   36 (85)
                      ++++++++-   ||+.-+|=.|||+++
T Consensus       315 ~~~k~~~wl---CygGgaGyggYg~~g  338 (379)
T KOG1432|consen  315 GELKGELWL---CYGGGAGYGGYGIGG  338 (379)
T ss_pred             cccCCeEEE---EecCCCccCCcCcCC
Confidence            344555554   999999999999875


No 21 
>KOG1044|consensus
Probab=23.62  E-value=26  Score=31.03  Aligned_cols=24  Identities=38%  Similarity=0.682  Sum_probs=19.2

Q ss_pred             cccceecCeeeecCCccccccCCcc
Q psy16163          7 SVTYTHKGVPYCHVPCYGALFGPQL   31 (85)
Q Consensus         7 g~~aehdgk~YC~k~CY~klFGPkG   31 (85)
                      |-.-.+||+||| -.||.+.||-|=
T Consensus       172 gey~skdg~pyc-e~dy~~~fgvkc  195 (670)
T KOG1044|consen  172 GEYMSKDGVPYC-EKDYQAKFGVKC  195 (670)
T ss_pred             ceeeccCCCcch-hhhhhhhcCeeh
Confidence            334568999999 599999999873


No 22 
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The oxygenase component may contain alpha and beta subunits, with the beta subunit having a purely structural function. Some oxygenase components contain only an alpha subunit. The oxygenase alpha subunit has two domains, an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from the reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Reduced pyridine nucleotide is used as the i
Probab=22.11  E-value=60  Score=20.63  Aligned_cols=19  Identities=21%  Similarity=0.286  Sum_probs=15.8

Q ss_pred             ecCeeeecCCccccccCCccc
Q psy16163         12 HKGVPYCHVPCYGALFGPQLF   32 (85)
Q Consensus        12 hdgk~YC~k~CY~klFGPkG~   32 (85)
                      .++.+.|  +||+..|...|-
T Consensus        57 ~~~~i~C--p~Hg~~Fd~~G~   75 (118)
T cd03469          57 NAGRLVC--PYHGWTYDLDGK   75 (118)
T ss_pred             CCCEEEC--CCCCCEECCCCc
Confidence            4567999  899999999953


No 23 
>PF07627 PSCyt3:  Protein of unknown function (DUF1588);  InterPro: IPR013039  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013042 from INTERPRO and IPR013043 from INTERPRO.
Probab=21.46  E-value=17  Score=24.57  Aligned_cols=25  Identities=24%  Similarity=0.452  Sum_probs=20.0

Q ss_pred             ceecCeeeecCCccccccCCccccCCc
Q psy16163         10 YTHKGVPYCHVPCYGALFGPQLFGHGT   36 (85)
Q Consensus        10 aehdgk~YC~k~CY~klFGPkG~G~G~   36 (85)
                      ..|...+.| ..|+. ++-|=||++=.
T Consensus        64 ~~h~~~~~C-a~CH~-~iDP~Gf~fE~   88 (101)
T PF07627_consen   64 EQHTENPAC-ASCHR-KIDPLGFAFEN   88 (101)
T ss_pred             HhhcCCCcH-HHHhh-hhCccchhhhc
Confidence            346677889 59999 89999988765


No 24 
>TIGR01213 conserved hypothetical protein TIGR01213. Members of this family show twilight-zone similarity to several predicted RNA pseudouridine synthases. All trusted members of this family are archaeal. Several eukaryotic homologs lack N-terminal homology including two CXXC motifs.
Probab=21.44  E-value=32  Score=28.46  Aligned_cols=20  Identities=35%  Similarity=0.775  Sum_probs=17.2

Q ss_pred             eeeecCCccccccCCccccCC
Q psy16163         15 VPYCHVPCYGALFGPQLFGHG   35 (85)
Q Consensus        15 k~YC~k~CY~klFGPkG~G~G   35 (85)
                      -|-|+ .|.+++|+-.|+|.+
T Consensus         8 ~plCd-~CLGR~Fa~~~~gl~   27 (388)
T TIGR01213         8 YPLCD-RCLGRLFAKLGHGTS   27 (388)
T ss_pred             CCCCc-cccchhhhhhccCCC
Confidence            36795 999999999999975


No 25 
>PHA03010 hypothetical protein; Provisional
Probab=21.25  E-value=42  Score=28.72  Aligned_cols=18  Identities=39%  Similarity=0.608  Sum_probs=15.4

Q ss_pred             hhhhheeeeCccceeEee
Q psy16163         65 LNLYNQYYDGKSGEIRSR   82 (85)
Q Consensus        65 LktYN~y~e~k~~~i~~r   82 (85)
                      =|+|||||+-++.+|-+.
T Consensus       382 Nki~NgyyNtet~EI~ss  399 (546)
T PHA03010        382 NKIFNCYYNTESEEIFSS  399 (546)
T ss_pred             CeeeeeEEecccceeeeh
Confidence            378999999999998774


Done!