BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy16169
         (139 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IY9|H Chain H, Leishmania Tarentolae Mitochondrial Large Ribosomal
          Subunit Model
          Length = 60

 Score = 28.1 bits (61), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 10/63 (15%)

Query: 37 DRVSRLKRELEQIRTEMNYTQRGLVPMGTRLAEMARMRLEYDETRKRIQIIQTQLADLEE 96
          D+V+ L    +Q+  +  Y +  LVP G  +            T+K I+  + + A+LE 
Sbjct: 7  DKVANLGSLGDQVNVKAGYARNFLVPQGKAV----------PATKKNIEFFEARRAELEA 56

Query: 97 KVT 99
          K+ 
Sbjct: 57 KLA 59


>pdb|1P85|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
          State Of E. Coli 70s Ribosome
 pdb|1P86|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The
          Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AW4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 50s Subunit Of One 70s Ribosome. The
          Entire Crystal Structure Contains Two 70s Ribosomes And
          Is Described In Remark 400.
 pdb|2AWB|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 50s Subunit Of The Second 70s Ribosome.
          The Entire Crystal Structure Contains Two 70s Ribosomes
          And Is Described In Remark 400.
 pdb|1VS6|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VS8|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2GYA|F Chain F, Structure Of The 50s Subunit Of A Pre-Translocational E.
          Coli Ribosome Obtained By Fitting Atomic Models For Rna
          And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYC|F Chain F, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
          Ribosome Complex Obtained By Fitting Atomic Models For
          Rna And Protein Components Into Cryo-Em Map Emd-1143
 pdb|2I2T|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2I2V|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2J28|H Chain H, Model Of E. Coli Srp Bound To 70s Rncs
 pdb|2QOV|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|2QOX|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|2QOZ|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QP1|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QAM|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QAO|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QBA|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QBC|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2QBE|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2QBG|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 pdb|2QBI|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBK|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4L|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Paromomycin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4N|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With
          Paromomycin And Rrf Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 pdb|2VHM|H Chain H, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 1 Of 4)
 pdb|2VHN|H Chain H, Structure Of Pdf Binding Helix In Complex With The
          Ribosome. (Part 2 Of 4)
 pdb|2RDO|H Chain H, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|3DF2|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|3DF4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 pdb|3BBX|H Chain H, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
          Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3FIK|H Chain H, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
          Consists Of The 50s Subunit.
 pdb|3E1B|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
          Pre-Accommodation State
 pdb|3E1D|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
          Post-Accommodation State
 pdb|3I1N|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I1P|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I1R|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I1T|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I20|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3I22|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 pdb|3KCR|H Chain H, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
          Ribosomal Subnit. The 30s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kc4
 pdb|2WWQ|H Chain H, E.Coli 70s Ribosome Stalled During Translation Of Tnac
          Leader Peptide. This File Contains The 50s, The P-Site
          Trna And The Tnac Leader Peptide (Part 2 Of 2).
 pdb|1VT2|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 pdb|3ORB|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Cem-101.
 pdb|3OFQ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 pdb|3OFR|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome With Erthromycin Bound.
 pdb|3OFC|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Chloramphenicol Bound.
 pdb|3OFD|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 pdb|3OFZ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Clindamycin.
 pdb|3OG0|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 pdb|3OAS|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 pdb|3OAT|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Telithromycin Bound.
 pdb|3IZT|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon.
 pdb|3IZU|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A Cognate
          Codon
 pdb|3J01|H Chain H, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
 pdb|3R8S|H Chain H, Structures Of The Bacterial Ribosome In Classical And
          Hybrid States Of Trna Binding
 pdb|3R8T|H Chain H, Structures Of The Bacterial Ribosome In Classical And
          Hybrid States Of Trna Binding
 pdb|3J0T|I Chain I, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class2 Of The Six
          Classes)
 pdb|3J0W|I Chain I, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 4a Of The Six
          Classes)
 pdb|3J0Y|I Chain I, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 4b Of The Six
          Classes)
 pdb|3J11|I Chain I, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 3 Of The Six
          Classes)
 pdb|3J12|I Chain I, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 5 Of The Six
          Classes)
 pdb|3J14|I Chain I, Structural Characterization Of Mrna-Trna Translocation
          Intermediates (50s Ribosome Of Class 6 Of The Six
          Classes)
 pdb|3J19|H Chain H, Structure Of The Bacterial Ribosome Complexed By
          Tmrna-Smpb And Ef-G During Translocation And
          Mld-Loading (50s Subunit)
 pdb|4GAR|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
          Antibiotics
 pdb|4GAU|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
          Antibiotics
          Length = 149

 Score = 27.3 bits (59), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 10/63 (15%)

Query: 37 DRVSRLKRELEQIRTEMNYTQRGLVPMGTRLAEMARMRLEYDETRKRIQIIQTQLADLEE 96
          D+V+ L    +Q+  +  Y +  LVP G  +            T+K I+  + + A+LE 
Sbjct: 7  DKVANLGSLGDQVNVKAGYARNFLVPQGKAV----------PATKKNIEFFEARRAELEA 56

Query: 97 KVT 99
          K+ 
Sbjct: 57 KLA 59


>pdb|1K3V|A Chain A, Porcine Parvovirus Capsid
          Length = 579

 Score = 26.9 bits (58), Expect = 3.8,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 21/41 (51%)

Query: 50 RTEMNYTQRGLVPMGTRLAEMARMRLEYDETRKRIQIIQTQ 90
          +TE  Y   GLV +    + +  + +   ET KRI ++ ++
Sbjct: 49 QTEFQYLGEGLVRITAHASRLIHLNMPEHETYKRIHVLNSE 89


>pdb|3G9G|A Chain A, Crystal Structure Of The N-Terminal EfcF-Bar Domain Of
          Syp1
          Length = 287

 Score = 26.2 bits (56), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 59 GLVPMGTRLAEMARMRLEYDET 80
          GLVP G+ +A M   R +Y ++
Sbjct: 13 GLVPRGSHMASMTEQRTKYADS 34


>pdb|3ED3|A Chain A, Crystal Structure Of The Yeast DithiolDISULFIDE
           Oxidoreductase Mpd1p
 pdb|3ED3|B Chain B, Crystal Structure Of The Yeast DithiolDISULFIDE
           Oxidoreductase Mpd1p
          Length = 298

 Score = 25.8 bits (55), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 8/48 (16%)

Query: 66  RLAEMARMRLEYDETRKRIQIIQTQLADLEEKVTPGQAESDKDRLILF 113
           +L ++  M   Y++T +  + +Q        KV P Q +SDK +L++F
Sbjct: 199 KLKQLTDMNPTYEKTPEIFKYLQ--------KVIPEQRQSDKSKLVVF 238


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,185,782
Number of Sequences: 62578
Number of extensions: 99859
Number of successful extensions: 379
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 368
Number of HSP's gapped (non-prelim): 23
length of query: 139
length of database: 14,973,337
effective HSP length: 89
effective length of query: 50
effective length of database: 9,403,895
effective search space: 470194750
effective search space used: 470194750
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 46 (22.3 bits)