Diaphorina citri psyllid: psy1620


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MTIKWKNGKYTEPPWMSPSSRQIVRSMLQVEPGKRIKIQDLLGHNWVKMGPEDNPVSFRPDHELREKDDDVIKVMADHKQLSPDDMWSQLNEWTYNYDTCTYLLLLSRKKQGLPLRLNTEFTRKYRSRQQFLFNMKYIDLRNQYILERTVGSGGFAKVKLATHVLTGEKVAIKIMKKATLGEDLPRVKLEINALKHISHQHICKLFQVIETSSHIFMVIEYCPGGELLDHIVERQRLGEKESRAFFRQILSAVAYLHHLGYAHRDLKPGGKETRTNLSGAVVVSTVVFESGGWWFATVSPVVKCLLVT
cccccccccccccccccHHHHHHHHHcccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccEEEEEEECccccEEEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHccccccccEEEEEEEccEEEEEEECcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccccccccccccccccccEEEEEc
MTIKWKNGKYTEPPWMSPSSRQIVRSMLQVEPGKRIKIQDLLGHNWVKMGPEDNPVSFR***E*REKDDDVIKVMADHKQLSPDDMWSQLNEWTYNYDTCTYLLLLSRKKQGLPLRLNTEFTRKYRSRQQFLFNMKYIDLRNQYILERTVGSGGFAKVKLATHVLTGEKVAIKIMKKATLGEDLPRVKLEINALKHISHQHICKLFQVIETSSHIFMVIEYCPGGELLDHIVERQRLGEKESRAFFRQILSAVAYLHHLGYAHRDLKPGGKETRTNLSGAVVVSTVVFESGGWWFATVSPVVKCLLVT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIKWKNGKYTEPPWMSPSSRQIVRSMLQVEPGKRIKIQDLLGHNWVKMGPEDNPVSFRPDHELREKDDDVIKVMADHKQLSPDDMWSQLNEWTYNYDTCTYLLLLSRKKQGLPLRLNTEFTRKYRSRQQFLFNMKYIDLRNQYILERTVGSGGFAKVKLATHVLTGEKVAIKIMKKATLGEDLPRVKLEINALKHISHQHICKLFQVIETSSHIFMVIEYCPGGELLDHIVERQRLGEKESRAFFRQILSAVAYLHHLGYAHRDLKPGGKETRTNLSGAVVVSTVVFESGGWWFATVSPVVKCLLVT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Maternal embryonic leucine zipper kinase Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.confidentQ61846
Maternal embryonic leucine zipper kinase Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Also plays a role in primitive hematopoiesis, possibly by affecting the expression of genes critical for hematopoiesis. Plays a role in cytokinesis during early development.confidentQ28GW8
Maternal embryonic leucine zipper kinase Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.confidentQ14680

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051049 [BP]regulation of transportprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0004715 [MF]non-membrane spanning protein tyrosine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004713, GO:0004672
GO:0035174 [MF]histone serine kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0035173, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0045821 [BP]positive regulation of glycolysisprobableGO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0031325, GO:0031323, GO:0010906, GO:0010907, GO:0050789, GO:0080090, GO:0010604, GO:0043467, GO:0065007, GO:0006110, GO:0048518, GO:0060255, GO:0031331, GO:0050794, GO:0045913, GO:0008150, GO:0010675, GO:0010676, GO:0019222, GO:0043470, GO:0043471, GO:0006109, GO:0048522
GO:0031000 [BP]response to caffeineprobableGO:0009719, GO:0050896, GO:1901698, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:0014074, GO:0010243, GO:0014070
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0009631 [BP]cold acclimationprobableGO:0009628, GO:0050896, GO:0006950, GO:0008150, GO:0009266, GO:0009409
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:1901701 [BP]cellular response to oxygen-containing compoundprobableGO:1901700, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0050995 [BP]negative regulation of lipid catabolic processprobableGO:0009894, GO:0009895, GO:0009892, GO:0080090, GO:0019222, GO:0019216, GO:0050994, GO:0008150, GO:0045833, GO:0065007, GO:0048519, GO:0050789
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005546 [MF]phosphatidylinositol-4,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0001764 [BP]neuron migrationprobableGO:0040011, GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0050793 [BP]regulation of developmental processprobableGO:0008150, GO:0065007, GO:0050789
GO:0050321 [MF]tau-protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043015 [MF]gamma-tubulin bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0001786 [MF]phosphatidylserine bindingprobableGO:0043168, GO:0072341, GO:0005543, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0016597
GO:0070300 [MF]phosphatidic acid bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0061351 [BP]neural precursor cell proliferationprobableGO:0008150, GO:0044699, GO:0008283
GO:0004679 [MF]AMP-activated protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0031588 [CC]AMP-activated protein kinase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:2000505 [BP]regulation of energy homeostasisprobableGO:0008150, GO:0065007, GO:0050789, GO:0051239, GO:0032844
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0071417 [BP]cellular response to organic nitrogenprobableGO:0071495, GO:0009719, GO:0051716, GO:0009987, GO:0050896, GO:1901698, GO:1901699, GO:0010033, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010243, GO:0044699
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0014823 [BP]response to activityprobableGO:0050896, GO:0008150
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0044732 [CC]mitotic spindle pole bodyprobableGO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:1900076 [BP]regulation of cellular response to insulin stimulusprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789, GO:0050794
GO:0042149 [BP]cellular response to glucose starvationprobableGO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0008610 [BP]lipid biosynthetic processprobableGO:1901576, GO:0044710, GO:0006629, GO:0044238, GO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0055089 [BP]fatty acid homeostasisprobableGO:0042592, GO:0050801, GO:0048878, GO:0055088, GO:0065007, GO:0008150, GO:0055081, GO:0065008

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UTO, chain A
Confidence level:very confident
Coverage over the Query: 139-299
View the alignment between query and template
View the model in PyMOL
Template: 3H4J, chain B
Confidence level:very confident
Coverage over the Query: 2-109
View the alignment between query and template
View the model in PyMOL
Template: 3I6W, chain A
Confidence level:confident
Coverage over the Query: 114-268
View the alignment between query and template
View the model in PyMOL