Query         psy16212
Match_columns 233
No_of_seqs    8 out of 10
Neff          1.6 
Searched_HMMs 46136
Date          Fri Aug 16 23:41:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16212.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16212hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07586 HXXSHH:  Protein of un  68.9     7.1 0.00015   33.7   3.9   28  125-152   181-208 (302)
  2 COG3360 Uncharacterized conser  44.8     3.5 7.7E-05   31.6  -1.7   36  127-162    27-67  (71)
  3 PF11662 DUF3263:  Protein of u  23.4      26 0.00055   26.8  -0.1   24  196-219    18-41  (77)
  4 PF10134 RPA:  Replication init  20.6      87  0.0019   26.9   2.5   25  135-159    90-114 (229)
  5 KOG0216|consensus               19.2      41 0.00089   36.0   0.3   66  146-219    86-153 (1111)
  6 PF10458 Val_tRNA-synt_C:  Valy  19.1 1.5E+02  0.0032   20.7   3.0   25  124-148    42-66  (66)
  7 cd02067 B12-binding B12 bindin  14.1 1.3E+02  0.0028   21.9   1.8   28  158-185    26-53  (119)
  8 PF05890 Ebp2:  Eukaryotic rRNA  13.1      82  0.0018   28.2   0.6   63  147-220    47-112 (271)
  9 PF06519 TolA:  TolA C-terminal  13.0 1.1E+02  0.0025   23.3   1.3   31  170-201    20-50  (96)
 10 smart00524 DWB Domain B in dwa  11.4 1.1E+02  0.0023   26.2   0.7   16  181-197   132-147 (171)

No 1  
>PF07586 HXXSHH:  Protein of unknown function (DUF1552);  InterPro: IPR011447 This is a family of proteins identified in Rhodopirellula baltica.
Probab=68.86  E-value=7.1  Score=33.70  Aligned_cols=28  Identities=21%  Similarity=0.376  Sum_probs=24.6

Q ss_pred             HHHhHHHhhhhHHHHHHHHHhhcccccc
Q psy16212        125 VTQTRLESYLSALEFIEAQLDRMKHTSY  152 (233)
Q Consensus       125 v~q~r~e~~~~~~~~~~~~~~~~~~~~~  152 (233)
                      ..|.|||.||.++.-||.+|+.+....-
T Consensus       181 ~Dr~kLd~yl~sireiE~rl~~~~~~~~  208 (302)
T PF07586_consen  181 EDRQKLDQYLDSIREIEKRLQQAEAWAD  208 (302)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhccc
Confidence            4599999999999999999998887663


No 2  
>COG3360 Uncharacterized conserved protein [Function unknown]
Probab=44.83  E-value=3.5  Score=31.62  Aligned_cols=36  Identities=31%  Similarity=0.438  Sum_probs=25.3

Q ss_pred             HhHHHhhhhHHHHHHHHHhhc-----ccccceeeeeeccee
Q psy16212        127 QTRLESYLSALEFIEAQLDRM-----KHTSYRTTLEVGFES  162 (233)
Q Consensus       127 q~r~e~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~  162 (233)
                      -+|++.-|..|++.|-+-.||     +-..|++||+|||+-
T Consensus        27 i~RA~~t~~~l~wfeV~~~rg~v~~g~v~hyqv~lkVgFrl   67 (71)
T COG3360          27 IARAADTLDNLDWFEVVETRGHVVDGAVAHYQVTLKVGFRL   67 (71)
T ss_pred             HHHHHhhhhcceEEEEEeecccEeecceEEEEEEEEEEEEe
Confidence            357777778887766544344     334499999999974


No 3  
>PF11662 DUF3263:  Protein of unknown function (DUF3263);  InterPro: IPR021678  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=23.39  E-value=26  Score=26.83  Aligned_cols=24  Identities=33%  Similarity=0.772  Sum_probs=21.4

Q ss_pred             ccccCcccchhhhhhccCCccccc
Q psy16212        196 MKSSGLKEKKLVETYGIRPSGYYL  219 (233)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~  219 (233)
                      .+..|-||.-+-+.+||.|.-||.
T Consensus        18 w~~~GaKe~aIre~fGls~~rYyq   41 (77)
T PF11662_consen   18 WRHGGAKEEAIREEFGLSPTRYYQ   41 (77)
T ss_pred             CcCCCCcHHHHHHHHCCCHHHHHH
Confidence            357799999999999999999984


No 4  
>PF10134 RPA:  Replication initiator protein A;  InterPro: IPR018777  Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination. 
Probab=20.55  E-value=87  Score=26.91  Aligned_cols=25  Identities=28%  Similarity=0.452  Sum_probs=20.6

Q ss_pred             hHHHHHHHHHhhcccccceeeeeec
Q psy16212        135 SALEFIEAQLDRMKHTSYRTTLEVG  159 (233)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~~~  159 (233)
                      ...+-|++-|+|++.|.|.|.+.-+
T Consensus        90 ~~Y~~L~~aL~RL~~T~i~t~~~~~  114 (229)
T PF10134_consen   90 RYYERLREALDRLQGTTIETNIRTG  114 (229)
T ss_pred             HHHHHHHHHHHHhcCCEEEEEEccC
Confidence            3567789999999999998887744


No 5  
>KOG0216|consensus
Probab=19.19  E-value=41  Score=36.00  Aligned_cols=66  Identities=24%  Similarity=0.412  Sum_probs=50.3

Q ss_pred             hcccccceeeeeecceeeccCCCcchhHHHhhhhhhhhhhhhccceeeecccccCcccchhhh--hhccCCccccc
Q psy16212        146 RMKHTSYRTTLEVGFESIHSGQSLVPESIQKSLMDIKYDVEKKLCSIRMSMKSSGLKEKKLVE--TYGIRPSGYYL  219 (233)
Q Consensus       146 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~  219 (233)
                      |-.+++|+-+|-|.+.--+.|-..++  |...|=.+-.-|-.|+|.++      |++.++||+  .--..-.|||+
T Consensus        86 RqR~~TY~Gkl~v~v~wsVNg~~~~~--e~~dlG~vPIMlrSklChL~------g~sp~eLV~hkEe~~EmGGYFI  153 (1111)
T KOG0216|consen   86 RQRGLTYKGKLVVRVSWSVNGGHVVI--EKRDLGHVPIMLRSKLCHLN------GASPKELVKHKEESSEMGGYFI  153 (1111)
T ss_pred             hhccceecceEEEEEEEEECCeeeee--eeeecCccceEEeccccccC------CCChHHHhhccCchhhcCcEEE
Confidence            55789999999999999999998888  44455555556788999886      788888887  33344457764


No 6  
>PF10458 Val_tRNA-synt_C:  Valyl tRNA synthetase tRNA binding arm;  InterPro: IPR019499 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This entry represents the C-terminal domain of Valyl-tRNA synthetase, which consists of two helices in a long alpha-hairpin. Valyl-tRNA synthetase (6.1.1.9 from EC) is an alpha monomer that belongs to class Ia.; GO: 0000166 nucleotide binding, 0004832 valine-tRNA ligase activity, 0005524 ATP binding, 0006438 valyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IVS_B 1GAX_B.
Probab=19.14  E-value=1.5e+02  Score=20.74  Aligned_cols=25  Identities=32%  Similarity=0.478  Sum_probs=18.7

Q ss_pred             hHHHhHHHhhhhHHHHHHHHHhhcc
Q psy16212        124 EVTQTRLESYLSALEFIEAQLDRMK  148 (233)
Q Consensus       124 ev~q~r~e~~~~~~~~~~~~~~~~~  148 (233)
                      +.++.+++.+..-++-|+++|..|+
T Consensus        42 e~er~kl~~~~~~~~~l~~~l~~Lk   66 (66)
T PF10458_consen   42 EKEREKLEELEEELEKLEEALEQLK   66 (66)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH--
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            4567788888888888888888775


No 7  
>cd02067 B12-binding B12 binding domain (B12-BD). This domain binds different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide, it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins.
Probab=14.12  E-value=1.3e+02  Score=21.88  Aligned_cols=28  Identities=32%  Similarity=0.488  Sum_probs=23.8

Q ss_pred             ecceeeccCCCcchhHHHhhhhhhhhhh
Q psy16212        158 VGFESIHSGQSLVPESIQKSLMDIKYDV  185 (233)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (233)
                      -||+.+..|..+-|+.+.+.+.+.+.|+
T Consensus        26 ~G~~V~~lg~~~~~~~l~~~~~~~~pdv   53 (119)
T cd02067          26 AGFEVIDLGVDVPPEEIVEAAKEEDADA   53 (119)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHcCCCE
Confidence            5899999999988899998888777775


No 8  
>PF05890 Ebp2:  Eukaryotic rRNA processing protein EBP2;  InterPro: IPR008610 This family consists of several eukaryotic rRNA processing protein EBP2 sequences. Ebp2p is required for the maturation of 25S rRNA and 60S subunit assembly. Ebp2p may be one of the target proteins of Rrs1p for executing the signal to regulate ribosome biogenesis [].
Probab=13.12  E-value=82  Score=28.23  Aligned_cols=63  Identities=22%  Similarity=0.474  Sum_probs=41.9

Q ss_pred             cccccceeeeeecceeeccCCCcchhHHHhhhhhhhhhhhhccceeeecccccCcccchhhhhhcc---CCcccccc
Q psy16212        147 MKHTSYRTTLEVGFESIHSGQSLVPESIQKSLMDIKYDVEKKLCSIRMSMKSSGLKEKKLVETYGI---RPSGYYLP  220 (233)
Q Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~  220 (233)
                      ++...|--||.|-          .|+.+...+-|+.-|...-+.-++..+.+- +.-..++...||   ||+.||-.
T Consensus        47 ~~~~pWiE~L~vt----------s~~~~~~~~~d~~dD~~RE~aFy~qAl~av-~~a~~~L~~~gip~~RP~DYfAE  112 (271)
T PF05890_consen   47 PKKLPWIETLDVT----------SPEPTDEQIKDVNDDLKRELAFYKQALEAV-KEARPRLKKLGIPFKRPDDYFAE  112 (271)
T ss_pred             cCCCCCeeEEeee----------cCccchhhhccccccHHHHHHHHHHHHHHH-HHHHHHHHHcCCCccCCCcchHH
Confidence            6667888888775          345556667777788777777666666532 333445566676   89999854


No 9  
>PF06519 TolA:  TolA C-terminal;  InterPro: IPR014161 TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cut-offs are based largely on conserved operon structure. The Tol-Pal complex is required for maintaining outer membrane integrity, and is also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins OmpC, PhoE and LamB.; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane; PDB: 2X9A_D 3QDP_A 3QDR_A 1TOL_A 1S62_A.
Probab=13.01  E-value=1.1e+02  Score=23.31  Aligned_cols=31  Identities=29%  Similarity=0.584  Sum_probs=20.0

Q ss_pred             chhHHHhhhhhhhhhhhhccceeeecccccCc
Q psy16212        170 VPESIQKSLMDIKYDVEKKLCSIRMSMKSSGL  201 (233)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  201 (233)
                      +-..||.-|.|-.. .--|-|.++|.|-..|+
T Consensus        20 I~~~Iq~~l~~~~~-y~GK~C~v~i~l~~dG~   50 (96)
T PF06519_consen   20 IKQAIQRNLYDDES-YKGKECRVRIRLAPDGL   50 (96)
T ss_dssp             HHHHHHTTTTTGGG-GTT--EEEEEEEETTSE
T ss_pred             HHHHHHHhcCCccc-cCCCEEEEEEEECCCCc
Confidence            44556665555432 34589999999999997


No 10 
>smart00524 DWB Domain B in dwarfin family proteins.
Probab=11.36  E-value=1.1e+02  Score=26.18  Aligned_cols=16  Identities=38%  Similarity=0.831  Sum_probs=12.9

Q ss_pred             hhhhhhhccceeeeccc
Q psy16212        181 IKYDVEKKLCSIRMSMK  197 (233)
Q Consensus       181 ~~~~~~~~~~~~~~~~~  197 (233)
                      -.||..+ +|+||||.-
T Consensus       132 ~~~~l~~-~c~iriSFv  147 (171)
T smart00524      132 GVYDLAR-MCTIRISFV  147 (171)
T ss_pred             cccchhh-heeEEEEEe
Confidence            4678777 999999963


Done!