Diaphorina citri psyllid: psy16222


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
ILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYRFLSQQLLEWCETNVLNVEQQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSFLAGGALKIERSVI
cccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHccHHHHHcccccEEEEECccccccccHHHHHHHHHHHHHHHHHccc
ILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYRFLSQQLLEWCETNVLNVEQQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSFLAGGALKIERSVI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYRFLSQQLLEWCETNVLNVEQQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSFLAGGALKIERSVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal multifunctional enzyme type 2 Bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. Catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids.confidentP51660
Peroxisomal hydratase-dehydrogenase-epimerase Second trifunctional enzyme acting on the beta-oxidation pathway for fatty acids, possessing hydratase-dehydrogenase-epimerase activities. Converts trans-2-enoyl-CoA via D-3-hydroxyacyl-CoA to 3-ketoacyl-CoA.confidentQ02207
Peroxisomal multifunctional enzyme A Enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. Protects the cells from the increase of the harmful xenobiotic fatty acids incorporated from their diets and optimizes cellular lipid composition for proper development.confidentQ9NKW1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003857 [MF]3-hydroxyacyl-CoA dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0004300 [MF]enoyl-CoA hydratase activityprobableGO:0016835, GO:0016836, GO:0003674, GO:0016829, GO:0003824
GO:0036111 [BP]very long-chain fatty-acyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793, GO:0035337
GO:0036112 [BP]medium-chain fatty-acyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793, GO:0035337
GO:0006635 [BP]fatty acid beta-oxidationprobableGO:0034440, GO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0044594 [MF]17-beta-hydroxysteroid dehydrogenase (NAD+) activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008209 [BP]androgen metabolic processprobableGO:0042445, GO:0044710, GO:0006629, GO:0044238, GO:0009987, GO:0044237, GO:0010817, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0065007, GO:0065008, GO:0034754, GO:1901360
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0008210 [BP]estrogen metabolic processprobableGO:0042445, GO:0044710, GO:0006629, GO:0044238, GO:0009987, GO:0044237, GO:0010817, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0065007, GO:0065008, GO:0034754, GO:1901360
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 3-143
View the alignment between query and template
View the model in PyMOL