Diaphorina citri psyllid: psy16234


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61
MSLKPKQVDFNKTWGSLQETIQGVITLGNVRRATWNDRFSDIYSLCVAYPEPLADRLYQETKLFLDQHLYVDIFETQFLEMSGEWYKSEASKLLQTCNVSQYMERVLQVLHEETNRSVRFLHVSSYPKVKAKCEQHMVADHLNFLQGECVPMVAEERRHDLANMYPLLRSVREGINILIDAVRDHICKQGLEAISGLSGDNISTQFVENMLAVHKKYKAFVKELFSGDQSFMGALDKACSSVINHKFDPKMPSKSPEYLAKYCDMLLKKSSKGLSESEMDDKLSQSITVFKYIDDKDVFHKFYAKMLAKRLIHQQSTSMDGEEAMINKLKQACGYEFTNKFHRMLTDIKISGGLNEKFHSEFVKTNEIDLGIHFSINILQAGSWPLGPTVISSFSVPQELEKCIHMFEKFYHGQFNGRKLSWLHNISQVELKLSYLKRPYFVTMQTFQMAILLLFEKNDAMTCGDIQTVLSLSQDQIGRHIASLVECKLLTSNKEELTEDTEIRLNLGYNNKRTKLKISGAVQKETPQEIERTVSSVDEDRKLYLQAAIVRIMKSRKQIRHNALIQEVLSQSKSFAPSISMIKKCIESLIDKNYVERTANSTDEYSYVA
ccccccccccHHHHHHHHHHHHHHHHcccccccHHcccccccHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEcccccEEEEEEECccccEEEEEcHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccEEEEcccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccECcccccccEEEcc
**LKPKQVDFNKTWGSLQETIQGVITLGNVRRATWNDRFSDIYSLCVAYPEPLADRLYQETKLFLDQHLYVDIFETQFLEMSGEWYKSEASKLLQTCNVSQYMERVLQVLHEETNRSVRFLHVSSYPKVKAKCEQHMVADHLNFLQGECVPMVAEERRHDLANMYPLLRSVREGINILIDAVRDHICKQGLEAISGLSGDNISTQFVENMLAVHKKYKAFVKELFSGDQSFMGALDKACSSVINHKFDPKMPSKSPEYLAKYCDMLLKK**********DDKLSQSITVFKYIDDKDVFHKFYAKMLAKRLIHQQSTSMDGEEAMINKLKQACGYEFTNKFHRMLTDIKISGGLNEKFHSEFVKTNEIDLGIHFSINILQAGSWPLGPTVISSFSVPQELEKCIHMFEKFYHGQFNGRKLSWLHNISQVELKLSYLKRPYFVTMQTFQMAILLLFEKNDAMTCGDIQTVLSLSQDQIGRHIASLVECKLLTSNKEELTEDTEIRLNLGYNNKRTKLK***********************RKLYLQAAIVRIMKSRKQIRHNALIQEVLSQSKSFAPSISMIKKCIESLIDKNYVERTANSTDEYSYVA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLKPKQVDFNKTWGSLQETIQGVITLGNVRRATWNDRFSDIYSLCVAYPEPLADRLYQETKLFLDQHLYVDIFETQFLEMSGEWYKSEASKLLQTCNVSQYMERVLQVLHEETNRSVRFLHVSSYPKVKAKCEQHMVADHLNFLQGECVPMVAEERRHDLANMYPLLRSVREGINILIDAVRDHICKQGLEAISGLSGDNISTQFVENMLAVHKKYKAFVKELFSGDQSFMGALDKACSSVINHKFDPKMPSKSPEYLAKYCDMLLKKSSKGLSESEMDDKLSQSITVFKYIDDKDVFHKFYAKMLAKRLIHQQSTSMDGEEAMINKLKQACGYEFTNKFHRMLTDIKISGGLNEKFHSEFVKTNEIDLGIHFSINILQAGSWPLGPTVISSFSVPQELEKCIHMFEKFYHGQFNGRKLSWLHNISQVELKLSYLKRPYFVTMQTFQMAILLLFEKNDAMTCGDIQTVLSLSQDQIGRHIASLVECKLLTSNKEELTEDTEIRLNLGYNNKRTKLKISGAVQKETPQEIERTVSSVDEDRKLYLQAAIVRIMKSRKQIRHNALIQEVLSQSKSFAPSISMIKKCIESLIDKNYVERTANSTDEYSYVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cullin-2 Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. May serve as a rigid scaffold in the complex and may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the ECS complex depends on the substrate recognition component. ECS(VHL) mediates the ubiquitination of hypoxia-inducible factor (HIF).confidentQ9D4H8
Cullin-2 Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. May serve as a rigid scaffold in the complex and may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the ECS complex depends on the substrate recognition component. ECS(VHL) mediates the ubiquitination of hypoxia-inducible factor (HIF).confidentQ13617
Cullin-2 Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. May serve as a rigid scaffold in the complex and may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the ECS complex depends on the substrate recognition component. ECS(VHL) mediates the ubiquitination of hypoxia-inducible factor (HIF).confidentQ5RCF3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0031462 [CC]Cul2-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0097193 [BP]intrinsic apoptotic signaling pathwayprobableGO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0097190, GO:0050794, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007569, GO:0050789, GO:0044699
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0031464 [CC]Cul4A-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0080008, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0061418 [BP]regulation of transcription from RNA polymerase II promoter in response to hypoxiaprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0001666, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0071453, GO:0010556, GO:0065007, GO:0071456, GO:0043620, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0044763, GO:0051171, GO:2001141, GO:0042221, GO:0070482, GO:0009628, GO:0036293, GO:0050896, GO:0051252, GO:0036294, GO:0006355, GO:0006357, GO:0033554, GO:0008150
GO:0019005 [CC]SCF ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008582 [BP]regulation of synaptic growth at neuromuscular junctionprobableGO:0048638, GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0048634, GO:0051128, GO:0032501, GO:0023052, GO:0051147, GO:0050789, GO:0044699, GO:0040008, GO:0060284, GO:0065007, GO:0048641, GO:0065008, GO:1901861, GO:0016202, GO:0009987, GO:0050793, GO:0050877, GO:0048742, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051963, GO:0044087, GO:0051960, GO:2000026, GO:0044763
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0010154 [BP]fruit developmentprobableGO:0032502, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0003006, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007295 [BP]growth of a germarium-derived egg chamberprobableGO:0032502, GO:0044767, GO:0044702, GO:0032504, GO:0040007, GO:0048589, GO:0022414, GO:0019953, GO:0007292, GO:0003006, GO:0032501, GO:0008150, GO:0007276, GO:0048609, GO:0048477, GO:0044699, GO:0000003
GO:0030891 [CC]VCB complexprobableGO:0005737, GO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0000153, GO:0005575, GO:0044444, GO:0044424, GO:0005622
GO:0001944 [BP]vasculature developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0009791 [BP]post-embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0007346 [BP]regulation of mitotic cell cycleprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0007307 [BP]eggshell chorion gene amplificationprobableGO:0048610, GO:0007306, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0007304, GO:0034645, GO:1901576, GO:0009653, GO:1901362, GO:0044699, GO:0006139, GO:0007276, GO:0000003, GO:0044260, GO:0030703, GO:0071840, GO:0030707, GO:0016043, GO:0032989, GO:0071704, GO:1901360, GO:0048477, GO:0048646, GO:0018130, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0044238, GO:0009987, GO:0006725, GO:0044767, GO:0022414, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0022412, GO:0034654, GO:0046483, GO:0007292, GO:0044702, GO:0044271, GO:0003006, GO:0048856, GO:0006277, GO:0044237, GO:0043170, GO:0044763, GO:0048869, GO:0006259, GO:0019438, GO:0071897
GO:0010948 [BP]negative regulation of cell cycle processprobableGO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LDJ, chain A
Confidence level:very confident
Coverage over the Query: 10-609
View the alignment between query and template
View the model in PyMOL