BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy16244
         (86 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QC1|B Chain B, Crystal Structure Of The Extracellular Domain Of The
          Nicotinic Acetylcholine Receptor 1 Subunit Bound To
          Alpha-Bungarotoxin At 1.9 A Resolution
          Length = 212

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 56/80 (70%), Gaps = 4/80 (5%)

Query: 4  NRVLKLLQNHETLL---VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60
          + V++ +++H  ++   V L+   L++   + NQI+TTN+ ++Q W DY L+W P +YGG
Sbjct: 17 SSVVRPVEDHREIVQVTVGLQLIQLINVDEV-NQIVTTNVRLKQQWVDYNLKWNPDDYGG 75

Query: 61 VHMLHVPSDHIWRPDIVLYN 80
          V  +H+PS+ IWRPD+VLYN
Sbjct: 76 VKKIHIPSEKIWRPDVVLYN 95


>pdb|4AQ5|A Chain A, Gating Movement In Acetylcholine Receptor Analysed By
           Time- Resolved Electron Cryo-Microscopy (Closed Class)
 pdb|4AQ5|D Chain D, Gating Movement In Acetylcholine Receptor Analysed By
           Time- Resolved Electron Cryo-Microscopy (Closed Class)
 pdb|4AQ9|A Chain A, Gating Movement In Acetylcholine Receptor Analysed By
           Time-Resolved Electron Cryo-Microscopy (Open Class)
 pdb|4AQ9|D Chain D, Gating Movement In Acetylcholine Receptor Analysed By
           Time-Resolved Electron Cryo-Microscopy (Open Class)
          Length = 461

 Score = 65.5 bits (158), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 52/80 (65%), Gaps = 4/80 (5%)

Query: 4   NRVLKLLQNHE---TLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60
           N+V++ +++H     + V L+   L++   + NQI+ TN+ + Q W D +LRW P +YGG
Sbjct: 40  NKVIRPVEHHTHFVDITVGLQLIQLINVDEV-NQIVETNVRLRQQWIDVRLRWNPADYGG 98

Query: 61  VHMLHVPSDHIWRPDIVLYN 80
           +  + +PSD +W PD+VLYN
Sbjct: 99  IKKIRLPSDDVWLPDLVLYN 118


>pdb|2BG9|A Chain A, Refined Structure Of The Nicotinic Acetylcholine
          Receptor At 4a Resolution.
 pdb|2BG9|D Chain D, Refined Structure Of The Nicotinic Acetylcholine
          Receptor At 4a Resolution
          Length = 370

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 52/80 (65%), Gaps = 4/80 (5%)

Query: 4  NRVLKLLQNHE---TLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60
          N+V++ +++H     + V L+   L++   + NQI+ TN+ + Q W D +LRW P +YGG
Sbjct: 16 NKVIRPVEHHTHFVDITVGLQLIQLINVDEV-NQIVETNVRLRQQWIDVRLRWNPADYGG 74

Query: 61 VHMLHVPSDHIWRPDIVLYN 80
          +  + +PSD +W PD+VLYN
Sbjct: 75 IKKIRLPSDDVWLPDLVLYN 94


>pdb|4AQ5|B Chain B, Gating Movement In Acetylcholine Receptor Analysed By
           Time- Resolved Electron Cryo-Microscopy (Closed Class)
 pdb|4AQ9|B Chain B, Gating Movement In Acetylcholine Receptor Analysed By
           Time-Resolved Electron Cryo-Microscopy (Open Class)
          Length = 493

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 22  TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
           T T L   N KN+ MTT++++  +W DY+L+W+P  Y G+  L +PSD +W+PDIVL N
Sbjct: 60  TLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSIPSDDVWQPDIVLMN 118


>pdb|2BG9|B Chain B, Refined Structure Of The Nicotinic Acetylcholine
          Receptor At 4a Resolution
          Length = 370

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 22 TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          T T L   N KN+ MTT++++  +W DY+L+W+P  Y G+  L +PSD +W+PDIVL N
Sbjct: 36 TLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSIPSDDVWQPDIVLMN 94


>pdb|2BG9|E Chain E, Refined Structure Of The Nicotinic Acetylcholine
          Receptor At 4a Resolution
          Length = 370

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 22 TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          T T L   N K + +TTN+W+E  W DY+L W   EY G+ ++ +PS+ +W PD+VL N
Sbjct: 35 TLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLEN 93


>pdb|4AQ5|E Chain E, Gating Movement In Acetylcholine Receptor Analysed By
          Time- Resolved Electron Cryo-Microscopy (Closed Class)
 pdb|4AQ9|E Chain E, Gating Movement In Acetylcholine Receptor Analysed By
          Time-Resolved Electron Cryo-Microscopy (Open Class)
          Length = 488

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 22 TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          T T L   N K + +TTN+W+E  W DY+L W   EY G+ ++ +PS+ +W PD+VL N
Sbjct: 35 TLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLEN 93


>pdb|2BG9|C Chain C, Refined Structure Of The Nicotinic Acetylcholine
          Receptor At 4a Resolution
          Length = 369

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 12 NHETLLVELRTATLLSRHNLK--NQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSD 69
          N+E + + L + TL +  +LK  ++ +TTN+W++ +WYD++L W   EY  + +L +  +
Sbjct: 27 NNEVVNIAL-SLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPE 85

Query: 70 HIWRPDIVLYN 80
           IW PDIVL N
Sbjct: 86 LIWIPDIVLQN 96


>pdb|4AQ5|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By
           Time- Resolved Electron Cryo-Microscopy (Closed Class)
 pdb|4AQ9|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By
           Time-Resolved Electron Cryo-Microscopy (Open Class)
          Length = 522

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 12  NHETLLVELRTATLLSRHNLK--NQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSD 69
           N+E + + L + TL +  +LK  ++ +TTN+W++ +WYD++L W   EY  + +L +  +
Sbjct: 48  NNEVVNIAL-SLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPE 106

Query: 70  HIWRPDIVLYN 80
            IW PDIVL N
Sbjct: 107 LIWIPDIVLQN 117


>pdb|3SQ6|A Chain A, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|B Chain B, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|C Chain C, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|D Chain D, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|E Chain E, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|F Chain F, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|G Chain G, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|H Chain H, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|I Chain I, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ6|J Chain J, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera With Its
          Agonist Epibatidine
 pdb|3SQ9|A Chain A, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|B Chain B, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|C Chain C, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|D Chain D, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|E Chain E, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|F Chain F, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|G Chain G, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|H Chain H, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|I Chain I, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
 pdb|3SQ9|J Chain J, Crystal Structures Of The Ligand Binding Domain Of A
          Pentameric Alpha7 Nicotinic Receptor Chimera
          Length = 204

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 32 KNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFT 83
          KNQ++    W++ SW D+ L+W   EY GV  + VP   +W PD+  YN  +
Sbjct: 44 KNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAIS 95


>pdb|4AFG|A Chain A, Capitella Teleta Achbp In Complex With Varenicline
 pdb|4AFG|B Chain B, Capitella Teleta Achbp In Complex With Varenicline
 pdb|4AFG|C Chain C, Capitella Teleta Achbp In Complex With Varenicline
 pdb|4AFG|D Chain D, Capitella Teleta Achbp In Complex With Varenicline
 pdb|4AFG|E Chain E, Capitella Teleta Achbp In Complex With Varenicline
 pdb|4AFH|A Chain A, Capitella Teleta Achbp In Complex With Lobeline
 pdb|4AFH|B Chain B, Capitella Teleta Achbp In Complex With Lobeline
 pdb|4AFH|C Chain C, Capitella Teleta Achbp In Complex With Lobeline
 pdb|4AFH|D Chain D, Capitella Teleta Achbp In Complex With Lobeline
 pdb|4AFH|E Chain E, Capitella Teleta Achbp In Complex With Lobeline
 pdb|4B5D|A Chain A, Capitella Teleta Achbp In Complex With Psychonicline
           (3-((2(S)-
           Azetidinyl)methoxy)-5-((1s,
           2r)-2-(2-Hydroxyethyl)cyclopropyl) Pyridine)
 pdb|4B5D|B Chain B, Capitella Teleta Achbp In Complex With Psychonicline
           (3-((2(S)-
           Azetidinyl)methoxy)-5-((1s,
           2r)-2-(2-Hydroxyethyl)cyclopropyl) Pyridine)
 pdb|4B5D|C Chain C, Capitella Teleta Achbp In Complex With Psychonicline
           (3-((2(S)-
           Azetidinyl)methoxy)-5-((1s,
           2r)-2-(2-Hydroxyethyl)cyclopropyl) Pyridine)
 pdb|4B5D|D Chain D, Capitella Teleta Achbp In Complex With Psychonicline
           (3-((2(S)-
           Azetidinyl)methoxy)-5-((1s,
           2r)-2-(2-Hydroxyethyl)cyclopropyl) Pyridine)
 pdb|4B5D|E Chain E, Capitella Teleta Achbp In Complex With Psychonicline
           (3-((2(S)-
           Azetidinyl)methoxy)-5-((1s,
           2r)-2-(2-Hydroxyethyl)cyclopropyl) Pyridine)
          Length = 230

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%)

Query: 33  NQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           N I T    V+ SW D  LRW+P+       + +  D IW PDI L+N 
Sbjct: 56  NSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNS 104


>pdb|3SIO|A Chain A, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|B Chain B, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|C Chain C, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|D Chain D, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|E Chain E, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|F Chain F, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|G Chain G, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|H Chain H, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|I Chain I, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
 pdb|3SIO|J Chain J, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10
           Linker) Mutated To Human Alpha-7 Nachr
          Length = 230

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           W +QSW    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 64  WEQQSWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 104


>pdb|3SH1|A Chain A, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|B Chain B, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|C Chain C, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|D Chain D, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|E Chain E, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|F Chain F, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|G Chain G, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|H Chain H, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|I Chain I, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
 pdb|3SH1|J Chain J, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr
          Length = 230

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           W +QSW    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 64  WEQQSWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 104


>pdb|3T4M|A Chain A, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|B Chain B, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|C Chain C, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|D Chain D, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|E Chain E, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|F Chain F, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|G Chain G, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|H Chain H, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|I Chain I, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
 pdb|3T4M|J Chain J, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7
           Nachr (Intermediate)
          Length = 230

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           W +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 64  WEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 104


>pdb|2YMD|A Chain A, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|B Chain B, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|C Chain C, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|D Chain D, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|E Chain E, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|F Chain F, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|G Chain G, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|H Chain H, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|I Chain I, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
 pdb|2YMD|J Chain J, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Serotonin
          (5-hydroxytryptamine)
          Length = 212

 Score = 37.0 bits (84), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (48%)

Query: 41 WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLY 79
          W +Q W    L W+P EYG +      +  IW PDI  Y
Sbjct: 53 WEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAY 91


>pdb|2YME|A Chain A, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|B Chain B, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|C Chain C, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|D Chain D, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|E Chain E, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|F Chain F, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|G Chain G, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|H Chain H, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|I Chain I, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
 pdb|2YME|J Chain J, Crystal Structure Of A Mutant Binding Protein
          (5htbp-achbp) In Complex With Granisetron
          Length = 205

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%)

Query: 41 WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
          W  Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 53 WERQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 93


>pdb|2XNT|A Chain A, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|B Chain B, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|C Chain C, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|D Chain D, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|E Chain E, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|F Chain F, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|G Chain G, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|H Chain H, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|I Chain I, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNT|J Chain J, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNU|A Chain A, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNU|B Chain B, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNU|C Chain C, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNU|D Chain D, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNU|E Chain E, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|A Chain A, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|B Chain B, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|C Chain C, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|D Chain D, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|E Chain E, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|F Chain F, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|G Chain G, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|H Chain H, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|I Chain I, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
 pdb|2XNV|J Chain J, Acetylcholine Binding Protein (Achbp) As Template For
           Hierarchical In Silico Screening Procedures To Identify
           Structurally Novel Ligands For The Nicotinic Receptors
          Length = 236

 Score = 35.0 bits (79), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 43  EQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 74  QQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 112


>pdb|2XZ5|A Chain A, Mmts-Modified Y53c Mutant Of Aplysia Achbp In Complex
          With Acetylcholine
 pdb|2XZ5|B Chain B, Mmts-Modified Y53c Mutant Of Aplysia Achbp In Complex
          With Acetylcholine
 pdb|2XZ5|C Chain C, Mmts-Modified Y53c Mutant Of Aplysia Achbp In Complex
          With Acetylcholine
 pdb|2XZ5|D Chain D, Mmts-Modified Y53c Mutant Of Aplysia Achbp In Complex
          With Acetylcholine
 pdb|2XZ5|E Chain E, Mmts-Modified Y53c Mutant Of Aplysia Achbp In Complex
          With Acetylcholine
          Length = 217

 Score = 35.0 bits (79), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 43 EQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
          +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 55 QQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 93


>pdb|2XZ6|A Chain A, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|B Chain B, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|C Chain C, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|D Chain D, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|E Chain E, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|F Chain F, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|G Chain G, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|H Chain H, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|I Chain I, Mtset-Modified Y53c Mutant Of Aplysia Achbp
 pdb|2XZ6|J Chain J, Mtset-Modified Y53c Mutant Of Aplysia Achbp
          Length = 217

 Score = 35.0 bits (79), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 43 EQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
          +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 55 QQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 93


>pdb|2BR7|A Chain A, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With Hepes
 pdb|2BR7|B Chain B, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With Hepes
 pdb|2BR7|C Chain C, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With Hepes
 pdb|2BR7|D Chain D, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With Hepes
 pdb|2BR7|E Chain E, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With Hepes
 pdb|2BR8|A Chain A, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With An
          Alpha- Conotoxin Pnia Variant
 pdb|2BR8|B Chain B, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With An
          Alpha- Conotoxin Pnia Variant
 pdb|2BR8|C Chain C, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With An
          Alpha- Conotoxin Pnia Variant
 pdb|2BR8|D Chain D, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With An
          Alpha- Conotoxin Pnia Variant
 pdb|2BR8|E Chain E, Crystal Structure Of Acetylcholine-Binding Protein
          (Achbp) From Aplysia Californica In Complex With An
          Alpha- Conotoxin Pnia Variant
 pdb|2C9T|A Chain A, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|B Chain B, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|C Chain C, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|D Chain D, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|E Chain E, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|F Chain F, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|G Chain G, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|H Chain H, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|I Chain I, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2C9T|J Chain J, Crystal Structure Of Acetylcholine Binding Protein
          (Achbp) From Aplysia Californica In Complex With
          Alpha-Conotoxin Imi
 pdb|2UZ6|A Chain A, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|B Chain B, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|C Chain C, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|D Chain D, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|E Chain E, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|F Chain F, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|G Chain G, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|H Chain H, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|I Chain I, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2UZ6|J Chain J, Achbp-targeted A-conotoxin Correlates Distinct Binding
          Orientations With Nachr Subtype Selectivity.
 pdb|2W8F|A Chain A, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|B Chain B, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|C Chain C, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|D Chain D, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|E Chain E, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|F Chain F, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|G Chain G, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|H Chain H, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|I Chain I, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8F|J Chain J, Aplysia Californica Achbp Bound To In Silico Compound 31
 pdb|2W8G|A Chain A, Aplysia Californica Achbp Bound To In Silico Compound 35
 pdb|2W8G|B Chain B, Aplysia Californica Achbp Bound To In Silico Compound 35
 pdb|2W8G|C Chain C, Aplysia Californica Achbp Bound To In Silico Compound 35
 pdb|2W8G|D Chain D, Aplysia Californica Achbp Bound To In Silico Compound 35
 pdb|2W8G|E Chain E, Aplysia Californica Achbp Bound To In Silico Compound 35
 pdb|2XYS|A Chain A, Crystal Structure Of Aplysia Californica Achbp In
          Complex With Strychnine
 pdb|2XYS|B Chain B, Crystal Structure Of Aplysia Californica Achbp In
          Complex With Strychnine
 pdb|2XYS|C Chain C, Crystal Structure Of Aplysia Californica Achbp In
          Complex With Strychnine
 pdb|2XYS|D Chain D, Crystal Structure Of Aplysia Californica Achbp In
          Complex With Strychnine
 pdb|2XYS|E Chain E, Crystal Structure Of Aplysia Californica Achbp In
          Complex With Strychnine
 pdb|2XYT|A Chain A, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|B Chain B, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|C Chain C, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|D Chain D, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|E Chain E, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|F Chain F, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|G Chain G, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|H Chain H, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|I Chain I, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2XYT|J Chain J, Crystal Structure Of Aplysia Californica Achbp In
          Complex With D-Tubocurarine
 pdb|2Y7Y|A Chain A, Aplysia Californica Achbp In Apo State
 pdb|2Y7Y|B Chain B, Aplysia Californica Achbp In Apo State
 pdb|2Y7Y|C Chain C, Aplysia Californica Achbp In Apo State
 pdb|2Y7Y|D Chain D, Aplysia Californica Achbp In Apo State
 pdb|2Y7Y|E Chain E, Aplysia Californica Achbp In Apo State
 pdb|2Y54|A Chain A, Fragment Growing Induces Conformational Changes In
          Acetylcholine- Binding Protein: A Structural And
          Thermodynamic Analysis - (Fragment 1)
 pdb|2Y54|B Chain B, Fragment Growing Induces Conformational Changes In
          Acetylcholine- Binding Protein: A Structural And
          Thermodynamic Analysis - (Fragment 1)
 pdb|2Y54|C Chain C, Fragment Growing Induces Conformational Changes In
          Acetylcholine- Binding Protein: A Structural And
          Thermodynamic Analysis - (Fragment 1)
 pdb|2Y54|D Chain D, Fragment Growing Induces Conformational Changes In
          Acetylcholine- Binding Protein: A Structural And
          Thermodynamic Analysis - (Fragment 1)
 pdb|2Y54|E Chain E, Fragment Growing Induces Conformational Changes In
          Acetylcholine- Binding Protein: A Structural And
          Thermodynamic Analysis - (Fragment 1)
 pdb|2Y56|A Chain A, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 3)
 pdb|2Y56|B Chain B, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 3)
 pdb|2Y56|C Chain C, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 3)
 pdb|2Y56|D Chain D, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 3)
 pdb|2Y56|E Chain E, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 3)
 pdb|2Y57|A Chain A, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 4)
 pdb|2Y57|B Chain B, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 4)
 pdb|2Y57|C Chain C, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 4)
 pdb|2Y57|D Chain D, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 4)
 pdb|2Y57|E Chain E, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 4)
 pdb|2Y58|A Chain A, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 6)
 pdb|2Y58|B Chain B, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 6)
 pdb|2Y58|C Chain C, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 6)
 pdb|2Y58|D Chain D, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 6)
 pdb|2Y58|E Chain E, Fragment Growing Induces Conformational Changes In
          Acetylcholine-Binding Protein: A Structural And
          Thermodynamic Analysis - (Compound 6)
 pdb|4AFO|A Chain A, Aplysia Californica Achbp In Complex With Cytisine
 pdb|4AFO|B Chain B, Aplysia Californica Achbp In Complex With Cytisine
 pdb|4AFO|C Chain C, Aplysia Californica Achbp In Complex With Cytisine
 pdb|4AFO|D Chain D, Aplysia Californica Achbp In Complex With Cytisine
 pdb|4AFO|E Chain E, Aplysia Californica Achbp In Complex With Cytisine
 pdb|4AFT|A Chain A, Aplysia Californica Achbp In Complex With Varenicline
 pdb|4AFT|B Chain B, Aplysia Californica Achbp In Complex With Varenicline
 pdb|4AFT|C Chain C, Aplysia Californica Achbp In Complex With Varenicline
 pdb|4AFT|D Chain D, Aplysia Californica Achbp In Complex With Varenicline
 pdb|4AFT|E Chain E, Aplysia Californica Achbp In Complex With Varenicline
          Length = 217

 Score = 35.0 bits (79), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41 WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
          + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 53 YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 93


>pdb|2BYN|A Chain A, Crystal Structure Of Apo Achbp From Aplysia Californica
 pdb|2BYN|B Chain B, Crystal Structure Of Apo Achbp From Aplysia Californica
 pdb|2BYN|C Chain C, Crystal Structure Of Apo Achbp From Aplysia Californica
 pdb|2BYN|D Chain D, Crystal Structure Of Apo Achbp From Aplysia Californica
 pdb|2BYN|E Chain E, Crystal Structure Of Apo Achbp From Aplysia Californica
 pdb|2BYQ|A Chain A, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Epibatidine
 pdb|2BYQ|B Chain B, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Epibatidine
 pdb|2BYQ|C Chain C, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Epibatidine
 pdb|2BYQ|D Chain D, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Epibatidine
 pdb|2BYQ|E Chain E, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Epibatidine
 pdb|2BYR|A Chain A, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|B Chain B, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|C Chain C, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|D Chain D, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|E Chain E, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|F Chain F, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|G Chain G, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|H Chain H, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|I Chain I, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYR|J Chain J, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Methyllycaconitine
 pdb|2BYS|A Chain A, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|B Chain B, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|C Chain C, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|D Chain D, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|E Chain E, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|F Chain F, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|G Chain G, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|H Chain H, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|I Chain I, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|2BYS|J Chain J, Crystal Structure Of Achbp From Aplysia Californica In
           Complex With Lobeline
 pdb|3C79|A Chain A, Crystal Structure Of Aplysia Californica Achbp In Complex
           With The Neonicotinoid Imidacloprid
 pdb|3C79|B Chain B, Crystal Structure Of Aplysia Californica Achbp In Complex
           With The Neonicotinoid Imidacloprid
 pdb|3C79|C Chain C, Crystal Structure Of Aplysia Californica Achbp In Complex
           With The Neonicotinoid Imidacloprid
 pdb|3C79|D Chain D, Crystal Structure Of Aplysia Californica Achbp In Complex
           With The Neonicotinoid Imidacloprid
 pdb|3C79|E Chain E, Crystal Structure Of Aplysia Californica Achbp In Complex
           With The Neonicotinoid Imidacloprid
 pdb|3C84|A Chain A, Crystal Structure Of A Complex Of Achbp From Aplysia
           Californica And The Neonicotinoid Thiacloprid
 pdb|3C84|B Chain B, Crystal Structure Of A Complex Of Achbp From Aplysia
           Californica And The Neonicotinoid Thiacloprid
 pdb|3C84|C Chain C, Crystal Structure Of A Complex Of Achbp From Aplysia
           Californica And The Neonicotinoid Thiacloprid
 pdb|3C84|D Chain D, Crystal Structure Of A Complex Of Achbp From Aplysia
           Californica And The Neonicotinoid Thiacloprid
 pdb|3C84|E Chain E, Crystal Structure Of A Complex Of Achbp From Aplysia
           Californica And The Neonicotinoid Thiacloprid
 pdb|2WNC|A Chain A, Crystal Structure Of Aplysia Achbp In Complex With
           Tropisetron
 pdb|2WNC|B Chain B, Crystal Structure Of Aplysia Achbp In Complex With
           Tropisetron
 pdb|2WNC|C Chain C, Crystal Structure Of Aplysia Achbp In Complex With
           Tropisetron
 pdb|2WNC|D Chain D, Crystal Structure Of Aplysia Achbp In Complex With
           Tropisetron
 pdb|2WNC|E Chain E, Crystal Structure Of Aplysia Achbp In Complex With
           Tropisetron
 pdb|2WNL|A Chain A, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|B Chain B, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|C Chain C, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|D Chain D, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|E Chain E, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|F Chain F, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|G Chain G, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|H Chain H, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|I Chain I, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
 pdb|2WNL|J Chain J, Crystal Structure Of Aplysia Achbp In Complex With
           Anabaseine
          Length = 227

 Score = 34.7 bits (78), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 63  YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 103


>pdb|3PMZ|A Chain A, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|B Chain B, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|C Chain C, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|D Chain D, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|E Chain E, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|F Chain F, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|G Chain G, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|H Chain H, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|I Chain I, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
 pdb|3PMZ|J Chain J, Crystal Structure Of The Complex Of Acetylcholine Binding
           Protein And D-Tubocurarine
          Length = 227

 Score = 34.7 bits (78), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 63  YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 103


>pdb|2PGZ|A Chain A, Crystal Structure Of Cocaine Bound To An Ach-binding
           Protein
 pdb|2PGZ|B Chain B, Crystal Structure Of Cocaine Bound To An Ach-binding
           Protein
 pdb|2PGZ|C Chain C, Crystal Structure Of Cocaine Bound To An Ach-binding
           Protein
 pdb|2PGZ|D Chain D, Crystal Structure Of Cocaine Bound To An Ach-binding
           Protein
 pdb|2PGZ|E Chain E, Crystal Structure Of Cocaine Bound To An Ach-binding
           Protein
 pdb|2PH9|A Chain A, Galanthamine Bound To An Ach-Binding Protein
 pdb|2PH9|B Chain B, Galanthamine Bound To An Ach-Binding Protein
 pdb|2PH9|C Chain C, Galanthamine Bound To An Ach-Binding Protein
 pdb|2PH9|D Chain D, Galanthamine Bound To An Ach-Binding Protein
 pdb|2PH9|E Chain E, Galanthamine Bound To An Ach-Binding Protein
 pdb|4DBM|A Chain A, Aplysia Californica-Achbp In Complex With Triazole 18
 pdb|4DBM|B Chain B, Aplysia Californica-Achbp In Complex With Triazole 18
 pdb|4DBM|C Chain C, Aplysia Californica-Achbp In Complex With Triazole 18
 pdb|4DBM|D Chain D, Aplysia Californica-Achbp In Complex With Triazole 18
 pdb|4DBM|E Chain E, Aplysia Californica-Achbp In Complex With Triazole 18
          Length = 230

 Score = 34.7 bits (78), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 64  YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 104


>pdb|2WN9|A Chain A, Crystal Structure Of Aplysia Achbp In Complex With 4-0h-
           Dmxba
 pdb|2WN9|B Chain B, Crystal Structure Of Aplysia Achbp In Complex With 4-0h-
           Dmxba
 pdb|2WN9|C Chain C, Crystal Structure Of Aplysia Achbp In Complex With 4-0h-
           Dmxba
 pdb|2WN9|D Chain D, Crystal Structure Of Aplysia Achbp In Complex With 4-0h-
           Dmxba
 pdb|2WN9|E Chain E, Crystal Structure Of Aplysia Achbp In Complex With 4-0h-
           Dmxba
 pdb|2WNJ|A Chain A, Crystal Structure Of Aplysia Achbp In Complex With Dmxba
 pdb|2WNJ|B Chain B, Crystal Structure Of Aplysia Achbp In Complex With Dmxba
 pdb|2WNJ|C Chain C, Crystal Structure Of Aplysia Achbp In Complex With Dmxba
 pdb|2WNJ|D Chain D, Crystal Structure Of Aplysia Achbp In Complex With Dmxba
 pdb|2WNJ|E Chain E, Crystal Structure Of Aplysia Achbp In Complex With Dmxba
 pdb|2WZY|A Chain A, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|B Chain B, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|C Chain C, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|D Chain D, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|E Chain E, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|F Chain F, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|G Chain G, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|H Chain H, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|I Chain I, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2WZY|J Chain J, Crystal Structure Of A-Achbp In Complex With 13-Desmethyl
           Spirolide C
 pdb|2X00|A Chain A, Crystal Structure Of A-Achbp In Complex With Gymnodimine A
 pdb|2X00|B Chain B, Crystal Structure Of A-Achbp In Complex With Gymnodimine A
 pdb|2X00|C Chain C, Crystal Structure Of A-Achbp In Complex With Gymnodimine A
 pdb|2X00|E Chain E, Crystal Structure Of A-Achbp In Complex With Gymnodimine A
 pdb|3PEO|A Chain A, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|B Chain B, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|C Chain C, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|D Chain D, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|E Chain E, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|F Chain F, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|G Chain G, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|H Chain H, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|I Chain I, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
 pdb|3PEO|J Chain J, Crystal Structure Of Acetylcholine Binding Protein
           Complexed With Metocurine
          Length = 228

 Score = 34.7 bits (78), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 64  YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 104


>pdb|2X00|D Chain D, Crystal Structure Of A-Achbp In Complex With Gymnodimine A
          Length = 227

 Score = 34.7 bits (78), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 63  YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 103


>pdb|2BYP|A Chain A, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Alpha-Conotoxin Imi
 pdb|2BYP|B Chain B, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Alpha-Conotoxin Imi
 pdb|2BYP|C Chain C, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Alpha-Conotoxin Imi
 pdb|2BYP|D Chain D, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Alpha-Conotoxin Imi
 pdb|2BYP|E Chain E, Crystal Structure Of Aplysia Californica Achbp In Complex
           With Alpha-Conotoxin Imi
          Length = 214

 Score = 34.7 bits (78), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 61  YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 101


>pdb|3GUA|A Chain A, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|B Chain B, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|C Chain C, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|D Chain D, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|E Chain E, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|F Chain F, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|G Chain G, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|H Chain H, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|I Chain I, Sulfates Bound In The Vestibule Of Achbp
 pdb|3GUA|J Chain J, Sulfates Bound In The Vestibule Of Achbp
          Length = 217

 Score = 34.7 bits (78), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 41  WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
           + +Q W    L W+P EYG +      +  IW PDI  Y+ 
Sbjct: 64  YEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSS 104


>pdb|4AOD|A Chain A, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          1 (Bgachbp1)
 pdb|4AOD|B Chain B, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          1 (Bgachbp1)
 pdb|4AOD|C Chain C, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          1 (Bgachbp1)
 pdb|4AOD|D Chain D, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          1 (Bgachbp1)
 pdb|4AOD|E Chain E, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          1 (Bgachbp1)
          Length = 205

 Score = 34.7 bits (78), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 28 RHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
          R +++N  +   LW    W D  L W   E+     L VP   IW PDI +++ 
Sbjct: 42 RADVENDEVDIGLWTTLVWKDRCLNWF-NEFTSFKELTVPIAEIWTPDIFIFDS 94


>pdb|4AOE|A Chain A, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          2 (Bgachbp2)
 pdb|4AOE|B Chain B, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          2 (Bgachbp2)
 pdb|4AOE|C Chain C, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          2 (Bgachbp2)
 pdb|4AOE|D Chain D, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          2 (Bgachbp2)
 pdb|4AOE|E Chain E, Biomphalaria Glabrata Acetylcholine-Binding Protein Type
          2 (Bgachbp2)
          Length = 205

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 39 NLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
           LW+  SW D  L W   E    + L +PS +IW P I +YN
Sbjct: 53 GLWLVISWKDRSLSWS-NECTTFNELTLPSKYIWLPHIEVYN 93


>pdb|2ZJU|A Chain A, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Imidacloprid
 pdb|2ZJU|B Chain B, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Imidacloprid
 pdb|2ZJU|C Chain C, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Imidacloprid
 pdb|2ZJU|D Chain D, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Imidacloprid
 pdb|2ZJU|E Chain E, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Imidacloprid
 pdb|2ZJV|A Chain A, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Clothianidin
 pdb|2ZJV|B Chain B, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Clothianidin
 pdb|2ZJV|C Chain C, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Clothianidin
 pdb|2ZJV|D Chain D, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Clothianidin
 pdb|2ZJV|E Chain E, Crystal Structure Of Lymnaea Stagnalis Acetylcholine
          Binding Protein (Ls-Achbp) Complexed With Clothianidin
          Length = 214

 Score = 30.0 bits (66), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 18 VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIV 77
          V L+   +L  + + N++     W + +W D  L W+         + VP   +W PD+ 
Sbjct: 35 VSLKFINILEVNEITNEVDVV-FWQQTTWSDRTLAWDSSH--SPDQVSVPISSLWVPDLA 91

Query: 78 LYNKFT 83
           YN  +
Sbjct: 92 AYNAIS 97


>pdb|4ALX|A Chain A, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|B Chain B, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|C Chain C, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|D Chain D, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|E Chain E, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|F Chain F, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|G Chain G, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|H Chain H, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|I Chain I, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|J Chain J, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
          Length = 229

 Score = 29.3 bits (64), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 18  VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIV 77
           V L+   +L  + + N++     W + +W D  L W          + VP   +W PD+ 
Sbjct: 50  VSLKFINILEVNEITNEVDVV-FWQQTTWSDRTLAWNSSH--SPDQVSVPISSLWVPDLA 106

Query: 78  LYNKFT 83
            YN  +
Sbjct: 107 AYNAIS 112


>pdb|1UW6|A Chain A, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|B Chain B, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|C Chain C, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|D Chain D, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|E Chain E, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|F Chain F, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|G Chain G, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|H Chain H, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|I Chain I, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|J Chain J, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|K Chain K, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|L Chain L, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|M Chain M, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|N Chain N, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|O Chain O, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|P Chain P, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|Q Chain Q, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|R Chain R, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|S Chain S, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
 pdb|1UW6|T Chain T, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Nicotine
          Length = 211

 Score = 28.9 bits (63), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 18 VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIV 77
          V L+   +L  + + N++     W + +W D  L W          + VP   +W PD+ 
Sbjct: 32 VSLKFINILEVNEITNEVDVV-FWQQTTWSDRTLAWNSSH--SPDQVSVPISSLWVPDLA 88

Query: 78 LYNKFT 83
           YN  +
Sbjct: 89 AYNAIS 94


>pdb|1UV6|A Chain A, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|B Chain B, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|C Chain C, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|D Chain D, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|E Chain E, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|F Chain F, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|G Chain G, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|H Chain H, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|I Chain I, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1UV6|J Chain J, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          In Complex With Carbamylcholine
 pdb|1YI5|A Chain A, Crystal Structure Of The A-Cobratoxin-Achbp Complex
 pdb|1YI5|B Chain B, Crystal Structure Of The A-Cobratoxin-Achbp Complex
 pdb|1YI5|C Chain C, Crystal Structure Of The A-Cobratoxin-Achbp Complex
 pdb|1YI5|D Chain D, Crystal Structure Of The A-Cobratoxin-Achbp Complex
 pdb|1YI5|E Chain E, Crystal Structure Of The A-Cobratoxin-Achbp Complex
 pdb|3U8J|B Chain B, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|A Chain A, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|C Chain C, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|D Chain D, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|E Chain E, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|F Chain F, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|G Chain G, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|J Chain J, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|I Chain I, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8J|H Chain H, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3531
          (1-(Pyridin-3-Yl)-1,4- Diazepane)
 pdb|3U8K|A Chain A, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|B Chain B, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|C Chain C, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|D Chain D, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|E Chain E, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|F Chain F, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|G Chain G, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|H Chain H, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|I Chain I, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|J Chain J, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|K Chain K, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|L Chain L, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|M Chain M, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|N Chain N, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|O Chain O, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|P Chain P, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|Q Chain Q, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|R Chain R, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|S Chain S, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8K|T Chain T, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3573
          (1-(5-Ethoxypyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|A Chain A, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|B Chain B, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|C Chain C, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|D Chain D, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|E Chain E, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|F Chain F, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|G Chain G, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|H Chain H, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|I Chain I, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8L|J Chain J, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3570
          (1-(5-Phenylpyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|A Chain A, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|B Chain B, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|C Chain C, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|D Chain D, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|E Chain E, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|F Chain F, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|G Chain G, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|H Chain H, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|I Chain I, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|J Chain J, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|K Chain K, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|L Chain L, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|M Chain M, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|N Chain N, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|O Chain O, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|P Chain P, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|Q Chain Q, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|R Chain R, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|S Chain S, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8M|T Chain T, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3920
          (1-(6-Bromopyridin-3-Yl)-1, 4-Diazepane)
 pdb|3U8N|A Chain A, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|B Chain B, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|C Chain C, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|D Chain D, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|E Chain E, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|F Chain F, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|G Chain G, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|H Chain H, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|I Chain I, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|J Chain J, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|K Chain K, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|L Chain L, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|M Chain M, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|N Chain N, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|O Chain O, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|P Chain P, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|Q Chain Q, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|R Chain R, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|S Chain S, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3U8N|T Chain T, Crystal Structure Of The Acetylcholine Binding Protein
          (Achbp) From Lymnaea Stagnalis In Complex With Ns3950
          (1-(6-Bromo-5-Ethoxypyridin- 3-Yl)-1,4-Diazepane)
 pdb|3ZDG|A Chain A, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|B Chain B, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|C Chain C, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|D Chain D, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|E Chain E, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|F Chain F, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|G Chain G, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|H Chain H, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|I Chain I, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|J Chain J, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|K Chain K, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|L Chain L, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|M Chain M, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|N Chain N, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|O Chain O, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|P Chain P, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|Q Chain Q, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|R Chain R, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|S Chain S, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDG|T Chain T, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue 3-(dimethylamino)butyl
          Dimethylcarbamate (dmabc)
 pdb|3ZDH|A Chain A, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|B Chain B, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|C Chain C, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|D Chain D, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|E Chain E, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|F Chain F, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|G Chain G, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|H Chain H, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|I Chain I, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
 pdb|3ZDH|J Chain J, Crystal Structure Of Ls-achbp Complexed With
          Carbamoylcholine Analogue N,n-dimethyl-4-(1-methyl-1h-
          Imidazol-2-yloxy)butan-2-amine
          Length = 210

 Score = 28.9 bits (63), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 18 VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIV 77
          V L+   +L  + + N++     W + +W D  L W          + VP   +W PD+ 
Sbjct: 31 VSLKFINILEVNEITNEVDVV-FWQQTTWSDRTLAWNSSH--SPDQVSVPISSLWVPDLA 87

Query: 78 LYNKFT 83
           YN  +
Sbjct: 88 AYNAIS 93


>pdb|1I9B|A Chain A, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1I9B|B Chain B, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1I9B|C Chain C, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1I9B|D Chain D, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1I9B|E Chain E, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          Length = 217

 Score = 28.9 bits (63), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 18  VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIV 77
           V L+   +L  + + N++     W + +W D  L W          + VP   +W PD+ 
Sbjct: 38  VSLKFINILEVNEITNEVDVV-FWQQTTWSDRTLAWNSSH--SPDQVSVPISSLWVPDLA 94

Query: 78  LYNKFT 83
            YN  +
Sbjct: 95  AYNAIS 100


>pdb|1UX2|A Chain A, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|B Chain B, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|C Chain C, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|D Chain D, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|E Chain E, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|F Chain F, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|G Chain G, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|H Chain H, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|I Chain I, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
 pdb|1UX2|J Chain J, X-Ray Structure Of Acetylcholine Binding Protein (Achbp)
          Length = 212

 Score = 28.9 bits (63), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 18 VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIV 77
          V L+   +L  + + N++     W + +W D  L W          + VP   +W PD+ 
Sbjct: 33 VSLKFINILEVNEITNEVDVV-FWQQTTWSDRTLAWNSSH--SPDQVSVPISSLWVPDLA 89

Query: 78 LYNKFT 83
           YN  +
Sbjct: 90 AYNAIS 95


>pdb|3Q8G|A Chain A, Resurrection Of A Functional Phosphatidylinositol Transfer
           Protein From A Pseudo-Sec14 Scaffold By Directed
           Evolution
          Length = 320

 Score = 26.9 bits (58), Expect = 3.0,   Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 55  PKEYGGVHMLHVPSDHIWRPDI 76
           P +YGG  +LH P+D  +  DI
Sbjct: 273 PVKYGGTSVLHNPNDKFYYSDI 294


>pdb|3B74|A Chain A, Crystal Structure Of Yeast Sec14 Homolog Sfh1 In Complex
           With Phosphatidylethanolamine
 pdb|3B7N|A Chain A, Crystal Structure Of Yeast Sec14 Homolog Sfh1 In Complex
           With Phosphatidylinositol
 pdb|3B7Q|A Chain A, Crystal Structure Of Yeast Sec14 Homolog Sfh1 In Complex
           With Phosphatidylcholine
 pdb|3B7Q|B Chain B, Crystal Structure Of Yeast Sec14 Homolog Sfh1 In Complex
           With Phosphatidylcholine
 pdb|3B7Z|A Chain A, Crystal Structure Of Yeast Sec14 Homolog Sfh1 In Complex
           With Phosphatidylcholine Or Phosphatidylinositol
          Length = 320

 Score = 26.9 bits (58), Expect = 3.2,   Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 55  PKEYGGVHMLHVPSDHIWRPDI 76
           P +YGG  +LH P+D  +  DI
Sbjct: 273 PVKYGGTSVLHNPNDKFYYSDI 294


>pdb|3D5Y|A Chain A, High Resolution Crystal Structure Of
          1,5-Alpha-Arabinanase Catalytic Mutant (Abnbe201a)
 pdb|3D5Z|A Chain A, Crystal Structure Analysis Of 1,5-Alpha-Arabinanase
          Catalytic Mutant (Abnbe201a) Complexed To Arabinotriose
          Length = 314

 Score = 25.8 bits (55), Expect = 5.9,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 9/40 (22%)

Query: 41 WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          WV  S  D+  ++ P++           DH+W PDI  YN
Sbjct: 61 WVFPSLPDWYKQYVPEK---------DEDHLWAPDICFYN 91


>pdb|3JR1|A Chain A, Crystal Structure Of Putative Fructosamine-3-Kinase
           (Yp_719053.1) From Haemophilus Somnus 129pt At 2.32 A
           Resolution
 pdb|3JR1|B Chain B, Crystal Structure Of Putative Fructosamine-3-Kinase
           (Yp_719053.1) From Haemophilus Somnus 129pt At 2.32 A
           Resolution
          Length = 312

 Score = 25.8 bits (55), Expect = 6.2,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 16  LLVELRTATLLSRHNLKNQIMTTNLWVE 43
           L+V++  A  LS+HN K  I+  NLW+E
Sbjct: 191 LIVQI-VADTLSKHNPKPSILHGNLWIE 217


>pdb|3D61|A Chain A, Crystal Structure Analysis Of 1,5-Alpha-Arabinanase
          Catalytic Mutant (Abnbd147a) Complexed To Arabinobiose
          Length = 314

 Score = 25.8 bits (55), Expect = 6.4,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 9/40 (22%)

Query: 41 WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          WV  S  D+  ++ P++           DH+W PDI  YN
Sbjct: 61 WVFPSLPDWYKQYVPEK---------DEDHLWAPDICFYN 91


>pdb|3D60|A Chain A, Crystal Structure Analysis Of 1,5-Alpha-Arabinanase
          Catalytic Mutant (D27a)
          Length = 314

 Score = 25.8 bits (55), Expect = 6.4,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 9/40 (22%)

Query: 41 WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          WV  S  D+  ++ P++           DH+W PDI  YN
Sbjct: 61 WVFPSLPDWYKQYVPEK---------DEDHLWAPDICFYN 91


>pdb|3CU9|A Chain A, High Resolution Crystal Structure Of
          1,5-Alpha-L-Arabinanase From Geobacillus
          Stearothermophilus
          Length = 314

 Score = 25.8 bits (55), Expect = 6.5,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 9/40 (22%)

Query: 41 WVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          WV  S  D+  ++ P++           DH+W PDI  YN
Sbjct: 61 WVFPSLPDWYKQYVPEK---------DEDHLWAPDICFYN 91


>pdb|1WL7|A Chain A, Structure Of The Thermostable Arabinanase
          Length = 312

 Score = 25.4 bits (54), Expect = 7.5,   Method: Composition-based stats.
 Identities = 8/12 (66%), Positives = 9/12 (75%)

Query: 69 DHIWRPDIVLYN 80
          DH+W PDI  YN
Sbjct: 80 DHLWAPDICFYN 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.451 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,809,231
Number of Sequences: 62578
Number of extensions: 100424
Number of successful extensions: 399
Number of sequences better than 100.0: 43
Number of HSP's better than 100.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 362
Number of HSP's gapped (non-prelim): 43
length of query: 86
length of database: 14,973,337
effective HSP length: 54
effective length of query: 32
effective length of database: 11,594,125
effective search space: 371012000
effective search space used: 371012000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)