Query         psy16245
Match_columns 113
No_of_seqs    115 out of 1074
Neff          6.8 
Searched_HMMs 46136
Date          Fri Aug 16 16:31:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16245.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16245hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4215|consensus               99.9 1.5E-28 3.2E-33  193.0   4.4   73   37-113    18-90  (432)
  2 cd06959 NR_DBD_EcR_like The DN  99.9 5.3E-28 1.2E-32  153.0   5.1   70   40-113     1-70  (73)
  3 cd06956 NR_DBD_RXR DNA-binding  99.9   7E-28 1.5E-32  153.9   4.8   70   40-113     2-71  (77)
  4 cd07172 NR_DBD_GR_PR DNA-bindi  99.9 1.1E-27 2.3E-32  153.4   5.5   72   38-113     2-73  (78)
  5 cd07173 NR_DBD_AR DNA-binding   99.9 1.4E-27   3E-32  154.2   5.9   71   39-113     4-74  (82)
  6 cd07156 NR_DBD_VDR_like The DN  99.9 6.6E-28 1.4E-32  152.2   3.8   69   41-113     1-69  (72)
  7 cd07171 NR_DBD_ER DNA-binding   99.9   1E-27 2.3E-32  154.8   4.8   71   39-113     4-74  (82)
  8 cd07160 NR_DBD_LXR DNA-binding  99.9 1.6E-27 3.4E-32  159.3   5.6   72   38-113    18-89  (101)
  9 cd07170 NR_DBD_ERR DNA-binding  99.9 1.1E-27 2.3E-32  159.1   4.5   72   38-113     4-75  (97)
 10 cd06963 NR_DBD_GR_like The DNA  99.9 1.4E-27   3E-32  151.2   4.8   69   41-113     1-69  (73)
 11 cd07179 2DBD_NR_DBD2 The secon  99.9 1.6E-27 3.5E-32  151.2   5.0   69   41-113     1-69  (74)
 12 cd07161 NR_DBD_EcR DNA-binding  99.9 2.1E-27 4.6E-32  156.1   5.2   71   39-113     2-72  (91)
 13 cd07155 NR_DBD_ER_like DNA-bin  99.9 1.5E-27 3.2E-32  151.7   4.2   69   41-113     1-69  (75)
 14 cd06969 NR_DBD_NGFI-B DNA-bind  99.9 5.7E-28 1.2E-32  153.6   2.0   70   40-113     2-71  (75)
 15 cd06961 NR_DBD_TR DNA-binding   99.9 1.7E-27 3.7E-32  154.7   4.1   70   40-113     1-70  (85)
 16 cd07158 NR_DBD_Ppar_like The D  99.9 2.4E-27 5.3E-32  149.9   4.5   69   41-113     1-70  (73)
 17 cd06958 NR_DBD_COUP_TF DNA-bin  99.9 1.9E-27 4.2E-32  150.4   4.1   69   41-113     1-69  (73)
 18 cd06962 NR_DBD_FXR DNA-binding  99.9 9.2E-28   2E-32  155.7   2.3   71   39-113     2-72  (84)
 19 cd07163 NR_DBD_TLX DNA-binding  99.9 8.5E-28 1.8E-32  158.2   1.8   76   36-113     4-79  (92)
 20 smart00399 ZnF_C4 c4 zinc fing  99.9 2.7E-27 5.9E-32  148.5   3.7   70   40-113     1-70  (70)
 21 cd07168 NR_DBD_DHR4_like DNA-b  99.9 3.8E-27 8.3E-32  154.5   4.5   72   38-113     6-77  (90)
 22 cd06964 NR_DBD_RAR DNA-binding  99.9 1.1E-27 2.4E-32  155.6   1.7   72   38-113     4-75  (85)
 23 cd06955 NR_DBD_VDR DNA-binding  99.9 2.6E-27 5.6E-32  159.7   3.4   73   37-113     5-77  (107)
 24 PF00105 zf-C4:  Zinc finger, C  99.9 5.4E-27 1.2E-31  146.8   4.2   69   40-112     2-70  (70)
 25 cd07162 NR_DBD_PXR DNA-binding  99.9 6.3E-27 1.4E-31  152.6   4.6   70   40-113     1-70  (87)
 26 cd07154 NR_DBD_PNR_like The DN  99.9 1.8E-27 3.9E-32  150.5   1.7   70   41-113     1-70  (73)
 27 cd06967 NR_DBD_TR2_like DNA-bi  99.9 2.1E-27 4.6E-32  154.9   1.7   72   38-113     3-74  (87)
 28 cd07169 NR_DBD_GCNF_like DNA-b  99.9 7.5E-27 1.6E-31  153.2   4.3   72   38-113     6-77  (90)
 29 cd07164 NR_DBD_PNR_like_1 DNA-  99.9 8.5E-27 1.8E-31  149.2   4.1   69   41-113     1-69  (78)
 30 cd06916 NR_DBD_like DNA-bindin  99.9   2E-27 4.3E-32  150.0   1.1   69   41-113     1-69  (72)
 31 cd06970 NR_DBD_PNR DNA-binding  99.9 2.8E-27 6.1E-32  155.7   1.7   72   39-113     7-78  (92)
 32 KOG4846|consensus               99.9   8E-27 1.7E-31  185.7   3.7   71   39-113   133-204 (538)
 33 cd06968 NR_DBD_ROR DNA-binding  99.9 1.1E-26 2.4E-31  153.7   3.6   72   38-113     5-76  (95)
 34 KOG4217|consensus               99.9 1.6E-26 3.5E-31  186.2   5.2   73   37-113   268-340 (605)
 35 cd07167 NR_DBD_Lrh-1_like The   99.9 1.1E-26 2.4E-31  153.2   3.3   69   41-113     1-69  (93)
 36 cd07157 2DBD_NR_DBD1 The first  99.9 6.1E-27 1.3E-31  152.4   2.0   70   40-113     2-73  (86)
 37 cd06960 NR_DBD_HNF4A DNA-bindi  99.9 6.2E-27 1.3E-31  149.1   1.7   69   41-113     1-69  (76)
 38 cd07165 NR_DBD_DmE78_like DNA-  99.9   2E-26 4.3E-31  148.4   3.7   69   41-113     1-69  (81)
 39 cd06966 NR_DBD_CAR DNA-binding  99.9 8.4E-27 1.8E-31  154.0   1.9   70   40-113     2-71  (94)
 40 cd06957 NR_DBD_PNR_like_2 DNA-  99.9 4.2E-27   9E-32  151.9  -0.3   70   41-113     1-70  (82)
 41 cd07166 NR_DBD_REV_ERB DNA-bin  99.9 1.3E-26 2.8E-31  151.8   1.6   71   39-113     4-75  (89)
 42 cd06965 NR_DBD_Ppar DNA-bindin  99.9 4.2E-26   9E-31  147.9   2.2   68   40-113     1-69  (84)
 43 KOG4216|consensus               99.9 1.8E-24   4E-29  171.1   3.9   72   38-113    46-117 (479)
 44 KOG4218|consensus               99.9 2.3E-22 5.1E-27  157.6   3.7   76   34-113    11-86  (475)
 45 PF01412 ArfGap:  Putative GTPa  69.8     1.8 3.8E-05   29.1   0.4   30   38-67     13-45  (116)
 46 smart00105 ArfGap Putative GTP  59.2     7.3 0.00016   25.9   1.8   31   38-68      3-36  (112)
 47 smart00401 ZnF_GATA zinc finge  44.9      16 0.00035   21.1   1.5   31   39-69      4-39  (52)
 48 PRK00420 hypothetical protein;  39.4     9.2  0.0002   26.0  -0.1   29   37-65     22-50  (112)
 49 PF10764 Gin:  Inhibitor of sig  34.2      33 0.00072   19.5   1.7   23   40-62      1-25  (46)
 50 PF00320 GATA:  GATA zinc finge  32.8      25 0.00054   18.6   1.0   12   57-68     22-33  (36)
 51 PF03107 C1_2:  C1 domain;  Int  30.9      25 0.00055   17.8   0.7   20   40-62      2-22  (30)
 52 PF10013 DUF2256:  Uncharacteri  30.3      34 0.00073   19.3   1.2   13   36-48      6-18  (42)
 53 TIGR00269 conserved hypothetic  30.0      28  0.0006   22.8   1.0   20   39-63     81-100 (104)
 54 PHA03124 dUTPase; Provisional   29.1      33 0.00072   28.2   1.5   16   56-71    191-206 (418)
 55 PF15279 SOBP:  Sine oculis-bin  28.1      57  0.0012   25.9   2.6   14    2-15     73-86  (306)
 56 PTZ00218 40S ribosomal protein  26.8      35 0.00076   20.2   0.9   23   39-61     17-40  (54)
 57 PF08394 Arc_trans_TRASH:  Arch  26.5      71  0.0015   17.4   2.1   12   56-67     24-35  (37)
 58 COG5347 GTPase-activating prot  25.8      30 0.00065   27.5   0.7   30   38-67     20-52  (319)
 59 cd00202 ZnF_GATA Zinc finger D  25.5      49  0.0011   19.2   1.4   28   41-68      2-34  (54)
 60 PF07649 C1_3:  C1-like domain;  22.6      32  0.0007   17.2   0.2   15   40-54      2-17  (30)
 61 cd00729 rubredoxin_SM Rubredox  22.4      40 0.00087   17.7   0.6   13   38-50     18-30  (34)
 62 PF05970 PIF1:  PIF1-like helic  22.2      30 0.00066   27.4   0.1   15    3-17    145-159 (364)
 63 PF10080 DUF2318:  Predicted me  22.0      36 0.00079   22.6   0.4   27   39-65     36-62  (102)
 64 PRK12495 hypothetical protein;  20.9      33 0.00072   26.1   0.1   29   37-66     41-69  (226)
 65 KOG0703|consensus               20.3      35 0.00076   26.9   0.1   30   38-67     25-57  (287)
 66 PF00357 Integrin_alpha:  Integ  20.2      46   0.001   14.6   0.4    9   63-71      3-11  (15)

No 1  
>KOG4215|consensus
Probab=99.95  E-value=1.5e-28  Score=193.02  Aligned_cols=73  Identities=48%  Similarity=1.153  Sum_probs=69.6

Q ss_pred             CCCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         37 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        37 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ....|.||||+++|.|||+.+|.+||+||||+|.++..|+|+.+.    +|.|+++.|+.||||||+||+.+||++|
T Consensus        18 ~~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k----~C~VDKdkRNaCRyCRfqKC~~aGMK~e   90 (432)
T KOG4215|consen   18 VAEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNK----QCVVDKDKRNACRYCRFQKCVRAGMKRE   90 (432)
T ss_pred             ccchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccc----cccccchhhhhhhHhhHHHHHHhcccHH
Confidence            357899999999999999999999999999999999999999974    7999999999999999999999999986


No 2  
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=99.94  E-value=5.3e-28  Score=152.99  Aligned_cols=70  Identities=49%  Similarity=1.126  Sum_probs=65.6

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         1 ~C~vCg~~~~~~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   70 (73)
T cd06959           1 NCVVCGDKASGFHYGVLSCEGCKGFFRRSVTKGAVYACKFGN----KCEMDMYMRRKCQECRLRKCKAAGMRPD   70 (73)
T ss_pred             CCceeCCcCcceEECceeehhhHHHHHHhhcCCCCccCCCCC----cCCcCCcccccCccchhHHHHHhCCChh
Confidence            599999999999999999999999999999988889998764    7999999999999999999999999985


No 3  
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=99.94  E-value=7e-28  Score=153.87  Aligned_cols=70  Identities=51%  Similarity=1.256  Sum_probs=65.6

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         2 ~C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   71 (77)
T cd06956           2 ICAICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK----DCLIDKRQRNRCQYCRYQKCLAMGMKRE   71 (77)
T ss_pred             CCcccCCcCcceEECceeehhHHHHHHHHhhCCCccccCCCC----ccccCCCccccCccchhHHHhHhCCCHH
Confidence            599999999999999999999999999999998889998764    7999999999999999999999999864


No 4  
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=99.94  E-value=1.1e-27  Score=153.45  Aligned_cols=72  Identities=43%  Similarity=0.959  Sum_probs=66.6

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +.+|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+.+
T Consensus         2 ~~~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   73 (78)
T cd07172           2 QKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRN----DCIIDKIRRKNCPACRLRKCLQAGMNLG   73 (78)
T ss_pred             CCCCeecCCcCcceEECceeehhhHHhHHHHeeCCCceeCCCCC----ccccCCcccccCccchhHHHHHhCCCcc
Confidence            45799999999999999999999999999999999889998754    7999999999999999999999999863


No 5  
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=99.94  E-value=1.4e-27  Score=154.22  Aligned_cols=71  Identities=42%  Similarity=0.984  Sum_probs=66.3

Q ss_pred             CCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      .+|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||+++
T Consensus         4 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   74 (82)
T cd07173           4 KTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN----DCTIDKFRRKNCPSCRLRKCFEAGMTLG   74 (82)
T ss_pred             CCCeecCCcCcceEECcchhhhHHHHHHHHhcCCCceecCCCC----ccccCCCccCcCcchhhhhhhhcCCCcC
Confidence            5799999999999999999999999999999988889998764    7999999999999999999999999874


No 6  
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=99.94  E-value=6.6e-28  Score=152.19  Aligned_cols=69  Identities=48%  Similarity=1.150  Sum_probs=64.8

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    +|.++...|..|++|||+|||++||++|
T Consensus         1 C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~   69 (72)
T cd07156           1 CGVCGDRATGYHFNAMTCEGCKGFFRRSMKRKARFTCPFNG----DCEITKDNRRHCQACRLKKCLDIGMKKE   69 (72)
T ss_pred             CCccCccCcccEECcceehhhhhhhchhccCcCccccCCCC----ccccCCcccccCccchhHHHHHhCCCHH
Confidence            78999999999999999999999999999988889998754    7999999999999999999999999975


No 7  
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=99.94  E-value=1e-27  Score=154.80  Aligned_cols=71  Identities=51%  Similarity=1.087  Sum_probs=66.3

Q ss_pred             CCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      .+|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||+++
T Consensus         4 ~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   74 (82)
T cd07171           4 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATN----QCTIDKNRRKSCQACRLRKCYEVGMMKG   74 (82)
T ss_pred             CCCeecCCcCcceEECceeehhhHHhHHHHeeCCCceeCCCCC----ccccCCcccccCccchhHHHhHhcCCHH
Confidence            5799999999999999999999999999999998889998754    7999999999999999999999999874


No 8  
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=99.94  E-value=1.6e-27  Score=159.34  Aligned_cols=72  Identities=44%  Similarity=1.059  Sum_probs=67.1

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ..+|.|||++++|+||||.+|++|++||||++.....|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus        18 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   89 (101)
T cd07160          18 NEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAQYVCKNGG----KCQMDMYMRRKCQECRLRKCREAGMREQ   89 (101)
T ss_pred             CCCCeecCCcCcceEECcceehhhhhhhhhcccccCccccCCCC----ccccCCcccccCccchhHHHHHhCCCHH
Confidence            46799999999999999999999999999999988889998764    7999999999999999999999999874


No 9  
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=99.94  E-value=1.1e-27  Score=159.13  Aligned_cols=72  Identities=47%  Similarity=0.996  Sum_probs=66.7

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ..+|.|||++++|+||||.+|+||++||||++.....|.|..++    .|.|+...|..|++|||+|||++||+++
T Consensus         4 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   75 (97)
T cd07170           4 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATN----ECEITKRRRKSCQACRFMKCLKVGMLKE   75 (97)
T ss_pred             CCCCeecCCcCcceEECceeehhhhHHHHHHhccCCceeecCCC----ccccCcccCccCCccccchhhhcCCCHH
Confidence            45799999999999999999999999999999998889998754    7999999999999999999999999864


No 10 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=99.94  E-value=1.4e-27  Score=151.17  Aligned_cols=69  Identities=43%  Similarity=1.028  Sum_probs=64.9

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         1 C~VCg~~a~~~hygv~sC~aCk~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   69 (73)
T cd06963           1 CLICGDEASGCHYGVLTCGSCKVFFKRAAEGQHNYLCAGRN----DCIIDKIRRKNCPACRLRKCYQAGMTLG   69 (73)
T ss_pred             CcccCccCcceEECceeehhhhHhHHHhhcCCCceeCCCCC----ccccCCcccccCccchhhHHHHcCCChh
Confidence            78999999999999999999999999999999889998764    7999999999999999999999999875


No 11 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.94  E-value=1.6e-27  Score=151.18  Aligned_cols=69  Identities=41%  Similarity=1.068  Sum_probs=65.0

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    +|.++...|..|++|||+|||++||++|
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~   69 (74)
T cd07179           1 CRVCGGKSSGFHFGALTCEGCKGFFRRTELSSNSYVCPGGQ----NCAITPATRNACKSCRFRRCLAVGMSKT   69 (74)
T ss_pred             CcccCccCcceEECceeehhHHHHHHHHhhCCCcccCCCCC----ccccCCcccccCccchhHHHHHhCCCHh
Confidence            78999999999999999999999999999998889998764    6999999999999999999999999975


No 12 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=99.94  E-value=2.1e-27  Score=156.05  Aligned_cols=71  Identities=45%  Similarity=1.044  Sum_probs=66.3

Q ss_pred             CCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ++|.|||++++|+||||.+|++|++||||++.....|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   72 (91)
T cd07161           2 ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYHCKYGR----ACEMDMYMRRKCQECRLKKCLSVGMRPE   72 (91)
T ss_pred             CCCeeCCCcCcceEECceeehhhHHHHHHHhccCCceecCCCC----ccccCccccccCccchhhHHhHcCCCHH
Confidence            4699999999999999999999999999999998889998764    7999999999999999999999999874


No 13 
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=99.94  E-value=1.5e-27  Score=151.68  Aligned_cols=69  Identities=49%  Similarity=1.091  Sum_probs=64.7

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    .|.|+...+..|++|||+|||++||+++
T Consensus         1 C~VC~~~~~g~hygv~sC~aCk~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   69 (75)
T cd07155           1 CLVCGDIASGYHYGVASCEACKAFFKRTIQGNLGYSCPSTS----ECEVDKKRRKSCQACRLQKCLKVGMLKE   69 (75)
T ss_pred             CcccCccCcceEEChhhhhhhHHHHHHHhhCCCceeCCcCC----CcccCCcccccCccchhhhhhHhCCCHH
Confidence            78999999999999999999999999999988889998764    6999999999999999999999999874


No 14 
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B. DNA-binding domain (DBD) of the orphan nuclear receptor, nerve growth factor-induced-B (NGFI-B) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NGFI-B interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. NGFI-B is a member of the nuclear-steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcrip
Probab=99.94  E-value=5.7e-28  Score=153.61  Aligned_cols=70  Identities=47%  Similarity=1.165  Sum_probs=65.6

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++.....|.|..++    +|.|+...|..|++|||+|||++||++|
T Consensus         2 ~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   71 (75)
T cd06969           2 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANK----NCPVDKRRRNRCQYCRFQKCLQVGMVKE   71 (75)
T ss_pred             CCeecCCcCcceEECcceeeeeeeeeeeeeecCCcccCCcCC----ccccCCcccccCcccHhHHHHHhCCCHH
Confidence            699999999999999999999999999999988889998754    7999999999999999999999999975


No 15 
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=99.94  E-value=1.7e-27  Score=154.70  Aligned_cols=70  Identities=50%  Similarity=1.227  Sum_probs=65.7

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   70 (85)
T cd06961           1 PCVVCGDKATGYHYRCITCEGCKGFFRRTVQKKLSYSCKGEG----KCEIDKVTRNQCQECRFKKCIAVGMAKD   70 (85)
T ss_pred             CCceeCCcCcceEEChhhhhhhhHhhHhhhccCCccccCCCC----ccccCccccccCccchhhhhhhccCCHH
Confidence            599999999999999999999999999999998889998764    7999999999999999999999999874


No 16 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=99.94  E-value=2.4e-27  Score=149.88  Aligned_cols=69  Identities=49%  Similarity=1.202  Sum_probs=64.7

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCccc-ccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVY-TCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~-~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..| .|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         1 C~VCg~~~~g~hyGv~~C~aC~~FFRR~v~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~   70 (73)
T cd07158           1 CKVCGDKASGFHYGVHSCEGCKGFFRRTIQHNLTYRRCLNGG----KCVIQRKNRNRCQYCRFKKCLSVGMSRN   70 (73)
T ss_pred             CcccCccCcceEECcchhhHHHHHHhhhhcCCCCcccCCCCC----CcCCCccccccCccchhhhhhHccCChH
Confidence            78999999999999999999999999999998888 898764    6999999999999999999999999975


No 17 
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=99.94  E-value=1.9e-27  Score=150.41  Aligned_cols=69  Identities=58%  Similarity=1.320  Sum_probs=64.6

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    +|.++...|..|++|||+|||++||+++
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~   69 (73)
T cd06958           1 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNR----NCPIDQHHRNQCQYCRLKKCLKVGMRRE   69 (73)
T ss_pred             CCccCccCcceEEChhhhhhhhhhhhhhhcCCCceeCCCCC----cCccCCcccccCccchhhHhhHhCCCHH
Confidence            78999999999999999999999999999998888998754    7999999999999999999999999975


No 18 
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=99.94  E-value=9.2e-28  Score=155.70  Aligned_cols=71  Identities=48%  Similarity=1.064  Sum_probs=66.3

Q ss_pred             CCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ++|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   72 (84)
T cd06962           2 ELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGG----NCEMDMYMRRKCQECRLRKCKEMGMLAE   72 (84)
T ss_pred             CCCeecCCcCcceEECcceeecceeeeeeeeccCCceecCCCC----cCccCccccccCccchhhHHHHhCCChH
Confidence            4699999999999999999999999999999988889998764    7999999999999999999999999874


No 19 
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.94  E-value=8.5e-28  Score=158.21  Aligned_cols=76  Identities=82%  Similarity=1.585  Sum_probs=68.2

Q ss_pred             CCCCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         36 LLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        36 ~~~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ++..+|.|||++++|+||||.+|+||++||||++..+..|.|..+.+  +.|.|+...|..|++|||+|||++||+++
T Consensus         4 ~~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~--~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   79 (92)
T cd07163           4 ILDIPCKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNRQYVCKSKGQ--GGCPVDKTHRNQCRACRLKKCFEVGMNKD   79 (92)
T ss_pred             ccCCCCcccCCcCcccEECceeeeeeeeEEeeeecCCCCcCCCCCCC--CCCccCCCccccCccchhhhhhhhcCCHH
Confidence            34678999999999999999999999999999999888899987421  37999999999999999999999999874


No 20 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=99.93  E-value=2.7e-27  Score=148.45  Aligned_cols=70  Identities=43%  Similarity=1.019  Sum_probs=65.7

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++..+..+.|..++    +|.|+...+..|++|||+|||++||++|
T Consensus         1 ~C~vC~~~~~~~hygv~~C~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~~GM~~~   70 (70)
T smart00399        1 LCCVCGDHASGFHFGVCSCRACKAFFRRTVNLRYKYRCDRKN----NCSINKRYRCRCRACRLKKCLGVGMDPE   70 (70)
T ss_pred             CCeEeCCcCcccEeCCcEechhhhhhhhheeCCCCeecCCCc----ccccCCCccccCccCcChhHhhccCcCC
Confidence            499999999999999999999999999999988889998764    6999999999999999999999999986


No 21 
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=99.93  E-value=3.8e-27  Score=154.53  Aligned_cols=72  Identities=46%  Similarity=1.102  Sum_probs=66.7

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ..+|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         6 ~~~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   77 (90)
T cd07168           6 PKLCSICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCVGDG----RCEITKAQRNRCQYCRFRKCIRKGMMLA   77 (90)
T ss_pred             CCCCcccCCcCcceEECceehhhhhHhhhhhhcCCCCccCCCCC----CccccccccccccccchhhhhhcCCCHH
Confidence            46799999999999999999999999999999998889998754    7999999999999999999999999864


No 22 
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter reg
Probab=99.93  E-value=1.1e-27  Score=155.65  Aligned_cols=72  Identities=54%  Similarity=1.168  Sum_probs=66.6

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ..+|.|||++++++||||.+|++|++||||++.....|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         4 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   75 (85)
T cd06964           4 YKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDK----NCIINKVTRNRCQYCRLQKCFEVGMSKE   75 (85)
T ss_pred             CCCCcccCCcCcccEECcceeeeeeeEEeeeecCCCCeECCCCC----ccccCCcccccCccchhhhhhhhCCCHH
Confidence            36799999999999999999999999999999988889998764    6999999999999999999999999874


No 23 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=99.93  E-value=2.6e-27  Score=159.70  Aligned_cols=73  Identities=44%  Similarity=1.055  Sum_probs=67.5

Q ss_pred             CCCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         37 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        37 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      .+.+|.|||+.++++||||.+|++|++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||+++
T Consensus         5 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   77 (107)
T cd06955           5 VPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNG----DCRITKDNRRHCQACRLKRCVDIGMMKE   77 (107)
T ss_pred             CCCCCeecCCcCcccEECcceeeeecceecceeccCCccccCCCC----ccccccCCccccccchhHHHHHcCCCch
Confidence            357899999999999999999999999999999998889998764    7999999999999999999999999874


No 24 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=99.93  E-value=5.4e-27  Score=146.80  Aligned_cols=69  Identities=51%  Similarity=1.191  Sum_probs=61.3

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNK  112 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~  112 (113)
                      +|.|||++++++||||.+|++|++||||++.....+.|..++    +|.++...+..|++|||+|||++||++
T Consensus         2 ~C~VCg~~~~~~~ygv~sC~~C~~FFrR~~~~~~~~~C~~~~----~C~i~~~~~~~C~~CRf~KCl~~GM~k   70 (70)
T PF00105_consen    2 KCKVCGDPASGYHYGVLSCNACKMFFRRSVKKKKPYKCKKNG----NCKIDKDNRRKCRSCRFQKCLEVGMKK   70 (70)
T ss_dssp             BSTTTSSBESEEETTEEEEHHHHHHHHHHHHTTCG-STSSSS----T---STTTTTTSHHHHHHHHHHTTBSG
T ss_pred             CCeECCCccCcccccccccccceeeeeecccccccccccccc----cccccccCCCEeCcchHHHHHHHCCcC
Confidence            699999999999999999999999999999999889999865    699999999999999999999999984


No 25 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=99.93  E-value=6.3e-27  Score=152.62  Aligned_cols=70  Identities=47%  Similarity=1.087  Sum_probs=65.4

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++.....|.|..++    +|.++...+..|++|||+|||++||++|
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   70 (87)
T cd07162           1 ICRVCGDRATGYHFNAMTCEGCKGFFRRAMKRNARLCCPFQK----GCVITKSNRRQCQACRLRKCLSIGMKKE   70 (87)
T ss_pred             CCcccCCcCcceEECcceehhhHHHHHhhhccCceeEcCCCC----ceecCCcccccCccchhhHHhHhCCCHH
Confidence            499999999999999999999999999999988888998764    6999999999999999999999999975


No 26 
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear
Probab=99.93  E-value=1.8e-27  Score=150.53  Aligned_cols=70  Identities=74%  Similarity=1.453  Sum_probs=64.3

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|...+   ++|.|+...|..|++|||+|||++||+++
T Consensus         1 C~vCg~~~~~~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~---~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   70 (73)
T cd07154           1 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNLLYTCKAGN---GSCVVDKARRNQCQACRLKKCLEVSMNKD   70 (73)
T ss_pred             CcccCccCcceEECcceeeeeeeEeeeeecCCCCcccCCCC---CCCccCCcccccCccchhhHhhHhCCChH
Confidence            78999999999999999999999999999998889998432   37999999999999999999999999975


No 27 
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=99.93  E-value=2.1e-27  Score=154.90  Aligned_cols=72  Identities=53%  Similarity=1.146  Sum_probs=66.8

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      .++|.|||++++++||||.+|++|++||||++..+..+.|..++    .|.|+...|..|++|||+|||++||+++
T Consensus         3 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   74 (87)
T cd06967           3 VELCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLGYSCRGSK----DCVINKHHRNRCQYCRLQKCLAMGMKSD   74 (87)
T ss_pred             CCCCeecCCcCCcCEeCcceEeeeeeEeeeeeeCCCCcccCCCC----ccccCccccccCccchhhhhhHcCCCHH
Confidence            46799999999999999999999999999999988889998754    7999999999999999999999999874


No 28 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.93  E-value=7.5e-27  Score=153.17  Aligned_cols=72  Identities=50%  Similarity=1.142  Sum_probs=66.9

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ..+|.|||++++++||||.+|++|++||||++..+..|.|..++    .|.|+...|..|++|||+|||++||+++
T Consensus         6 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   77 (90)
T cd07169           6 QRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDK----NCVMSRKQRNRCQYCRLLKCLQMGMNRK   77 (90)
T ss_pred             CCCCeecCCcCcceEECcceehhhHHHHHHHhcCCCceecCCCC----cccccccccccccccchhhhccccCCHH
Confidence            46799999999999999999999999999999998889998754    6999999999999999999999999874


No 29 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=99.93  E-value=8.5e-27  Score=149.16  Aligned_cols=69  Identities=64%  Similarity=1.344  Sum_probs=64.7

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||+++
T Consensus         1 C~VCg~~~~g~hyG~~~C~~C~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   69 (78)
T cd07164           1 CRVCGDRASGKHYGVPSCDGCRGFFKRSIRRNLAYVCKENG----SCVVDVARRNQCQACRFKKCLQVNMNRD   69 (78)
T ss_pred             CcccCccCcceEECcchhhhhhhhhhhhccCCCCccCCCCC----cccccCcccccCccchhhhhhHhcCCHH
Confidence            78999999999999999999999999999988889998864    7999999999999999999999999874


No 30 
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with a specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).  Most nuclear receptors bind as homodimers or hetero
Probab=99.93  E-value=2e-27  Score=149.96  Aligned_cols=69  Identities=58%  Similarity=1.297  Sum_probs=64.8

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    .|.|+...|..|++|||+|||++||+++
T Consensus         1 C~vC~~~~~~~hygv~sC~aC~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~   69 (72)
T cd06916           1 CAVCGDKASGYHYGVLTCEGCKGFFRRSVRRNLEYTCPAGG----NCVIDKRNRNRCQACRLKKCLAVGMRKE   69 (72)
T ss_pred             CCccCccCcccEECcceeeeeeeeEeEeecCCCCccCCCCC----ccccCCcccccCccchhhHhhHhCCChH
Confidence            78999999999999999999999999999988889998764    6999999999999999999999999975


No 31 
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=99.93  E-value=2.8e-27  Score=155.73  Aligned_cols=72  Identities=67%  Similarity=1.418  Sum_probs=66.3

Q ss_pred             CCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      .+|.|||++++|+||||.+|++|++||||++..+..|.|..+.   ++|.|+...|..|++|||+|||++||+++
T Consensus         7 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~---~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   78 (92)
T cd06970           7 LLCRVCGDTSSGKHYGIYACNGCSGFFKRSVRRKLIYRCQAGT---GMCPVDKAHRNQCQACRLKKCLQAGMNKD   78 (92)
T ss_pred             CCCeecCCcCcccEECccEEeeeeeEeeeeeecCCCceeecCC---CcCccCCCccccCccchhhHhhHhCCCHH
Confidence            5799999999999999999999999999999999889998752   27999999999999999999999999874


No 32 
>KOG4846|consensus
Probab=99.93  E-value=8e-27  Score=185.72  Aligned_cols=71  Identities=48%  Similarity=1.102  Sum_probs=66.5

Q ss_pred             CCceecCCCCcceeeccccchhhHHHHHHHhhcCccc-ccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVY-TCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~-~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ..|+||||+++|+||||.+|++||+||||+|+.+..| .|-+..    .|.|...+|++|++|||+|||.|||++|
T Consensus       133 ~lCkVCgDkASGfHYGV~aCEGCKGFFRRSIQqkI~YrrClk~e----~C~I~R~nRNRCQ~CRfKKCL~vGMSrD  204 (538)
T KOG4846|consen  133 SLCKVCGDKASGFHYGVTACEGCKGFFRRSIQQKIDYRRCLKQE----VCEIKRENRNRCQYCRFKKCLDVGMSRD  204 (538)
T ss_pred             EeehhhccccccceeceeecccchHHHHHHHHHhhhHHHHhhhh----ceehhhhccchhhhhhHHHHHhcccchh
Confidence            3699999999999999999999999999999999999 787764    7999999999999999999999999875


No 33 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=99.93  E-value=1.1e-26  Score=153.74  Aligned_cols=72  Identities=54%  Similarity=1.225  Sum_probs=66.9

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ..+|.|||++++++||||.+|++|++||||++..+..|.|..++    +|.++...|..|++|||+|||++||+++
T Consensus         5 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   76 (95)
T cd06968           5 VIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNVSYSCPRQK----NCLIDRTNRNRCQHCRLQKCLALGMSRD   76 (95)
T ss_pred             ccCCcccCCcCcceEECceeehhhHHhhHHheeCCCceecCCCc----ccccccCCceeccccchhhcccccCChh
Confidence            45899999999999999999999999999999988889998754    7999999999999999999999999874


No 34 
>KOG4217|consensus
Probab=99.93  E-value=1.6e-26  Score=186.17  Aligned_cols=73  Identities=45%  Similarity=1.105  Sum_probs=68.8

Q ss_pred             CCCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         37 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        37 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      ....|+||||.+...||||.+|++||+||+|+|+++..|+|-.+.    +|.|++..|++|++|||+|||+|||=+|
T Consensus       268 ~e~~CAVCgDnAaCqHYGvRTCEGCKGFFKRTVQKnaKYvClanK----nCPVDKRrRnRCQyCRfQKCL~VGMVKE  340 (605)
T KOG4217|consen  268 AEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANK----NCPVDKRRRNRCQYCRFQKCLAVGMVKE  340 (605)
T ss_pred             ccceeeecCChHHhhhcCccccccchHHHHHHHhcCCeeEeecCC----CCCcchhhhhhchhhhHhHHHHhhhhhh
Confidence            367899999999999999999999999999999999999998874    7999999999999999999999999765


No 35 
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which is required at several stages of development. Particularly, FTZ-F1 regulated genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development; SF-1 is an essential regu
Probab=99.93  E-value=1.1e-26  Score=153.17  Aligned_cols=69  Identities=46%  Similarity=1.133  Sum_probs=64.9

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.||+++++++||||.+|++|++||||++..+..|.|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         1 C~VCg~~a~g~hyGv~sC~aCk~FFRRsv~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   69 (93)
T cd07167           1 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKRYTCIENQ----NCQIDKTQRKRCPYCRFQKCLSVGMKLE   69 (93)
T ss_pred             CcccCccCcceEECchhhhhHHHHHHHHeeCCCccccCCCC----ccccCccccCcCCCcccchhhhccCCHH
Confidence            78999999999999999999999999999999999998864    7999999999999999999999999864


No 36 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.93  E-value=6.1e-27  Score=152.42  Aligned_cols=70  Identities=40%  Similarity=0.926  Sum_probs=63.9

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCc--ccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNR--VYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~--~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++....  .|.|..++    +|.++...|..|++|||+|||+|||+++
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~aCk~FFRR~~~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   73 (86)
T cd07157           2 TCQVCGEPAAGFHHGAYVCEACKKFFMRSSNAISFTISECPNGG----KCIIDKKNRTKCQACRYRKCLNVGMSLG   73 (86)
T ss_pred             CCcccCCcCcccEECcceeeEeeeEEecceecCCCccccCCCCC----ccccCccccccCccchhhHHhHcCCCcc
Confidence            5999999999999999999999999999998664  78898764    7999999999999999999999999864


No 37 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=99.93  E-value=6.2e-27  Score=149.06  Aligned_cols=69  Identities=55%  Similarity=1.310  Sum_probs=64.6

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++..+..|.|..++    .|.|+...+..|++|||+|||++||+++
T Consensus         1 C~vCg~~~~~~hygv~~C~aC~~FFrR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~   69 (76)
T cd06960           1 CAVCGDRATGKHYGVLSCNGCKGFFRRSVRKNRTYTCRFGG----NCVVDKDKRNACRYCRFKKCLEVGMDPE   69 (76)
T ss_pred             CCccCccCcccEECcceeeeehheeCccccCCCceeCCCCC----cccccCcccccCccchhhhhhhcCCCHH
Confidence            78999999999999999999999999999988889998764    7999999999999999999999999874


No 38 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=99.93  E-value=2e-26  Score=148.45  Aligned_cols=69  Identities=52%  Similarity=1.210  Sum_probs=64.7

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++++||||.+|++|++||||++.....|.|..++    +|.|+...+..|++|||+|||++||+++
T Consensus         1 C~VCg~~~~g~hyG~~sC~aC~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~   69 (81)
T cd07165           1 CKVCGDKASGYHYGVTSCEGCKGFFRRSIQKQIEYRCLRDG----KCEIIRLNRNRCQYCRFKKCLAAGMSKD   69 (81)
T ss_pred             CCccCccCcceEECchhhhhHHHHHHhHhccCCceeCCCCC----CccccccccccccchhhhhcccccCCHH
Confidence            78999999999999999999999999999988889998764    7999999999999999999999999874


No 39 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=99.92  E-value=8.4e-27  Score=154.03  Aligned_cols=70  Identities=36%  Similarity=0.939  Sum_probs=65.6

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++++||||.+|++|++||||++.....|.|..++    +|.++...+..|++|||+|||++||+++
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   71 (94)
T cd06966           2 ICGVCGDKALGYNFNAITCESCKAFFRRNALKNKEFKCPFNE----SCEINVVTRRFCQKCRLDKCFAIGMKKE   71 (94)
T ss_pred             CCeeCCCcCcceEECcceeeeehheehhcccCCCccccCCCC----ccccCccccccCccchhhhCcccCCCHH
Confidence            699999999999999999999999999999988889998764    7999999999999999999999999874


No 40 
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members 
Probab=99.92  E-value=4.2e-27  Score=151.95  Aligned_cols=70  Identities=60%  Similarity=1.276  Sum_probs=64.4

Q ss_pred             ceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         41 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        41 C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      |.|||++++|+||||.+|++|++||||++..+..|.|...+   +.|.|+...|..|++|||+|||++||+++
T Consensus         1 C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~---~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   70 (82)
T cd06957           1 CKVCGDKSYGKHYGVYCCDGCSCFFKRSVRKGIIYTCIAGN---GNCVVDKARRNWCPFCRLQKCFAVGMNRA   70 (82)
T ss_pred             CCccCccCcceEECcceEeeeeeEEEEeecCCCceEccCcc---CCCccCCCccCcccCcchhhcccccCCHH
Confidence            78999999999999999999999999999988889998532   37999999999999999999999999864


No 41 
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=99.92  E-value=1.3e-26  Score=151.75  Aligned_cols=71  Identities=46%  Similarity=1.137  Sum_probs=65.5

Q ss_pred             CCceecCCCCcceeeccccchhhHHHHHHHhhcCccc-ccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVY-TCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~-~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      .+|.|||++++++||||.+|++|++||||++..+..| .|..++    +|.|+...|..|++|||+|||++||+++
T Consensus         4 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   75 (89)
T cd07166           4 VLCKVCGDKASGFHYGVHACEGCKGFFRRSIQQKIQYRKCTKNE----TCSIMRINRNRCQYCRFKKCLAVGMSRD   75 (89)
T ss_pred             CCCcccCccCcceEEChhhhhhHhhEecceeEcCCcchhhccCC----cccccccccccccchhhhhcccccCCHH
Confidence            5799999999999999999999999999999988888 588764    7999999999999999999999999874


No 42 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=99.92  E-value=4.2e-26  Score=147.89  Aligned_cols=68  Identities=47%  Similarity=1.158  Sum_probs=62.5

Q ss_pred             CceecCCCCcceeeccccchhhHHHHHHHhhcCccc-ccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         40 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVY-TCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        40 ~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~-~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +|.|||++++|+||||.+|++|++||||++..+..| .|..      .|.|+...+..|++|||+|||++||+++
T Consensus         1 ~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~------~C~i~~~~r~~Cr~CRl~KCl~vGM~~~   69 (84)
T cd06965           1 ECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLVYKPCDL------SCKIHKKSRNKCQYCRFQKCLNVGMSHN   69 (84)
T ss_pred             CCcccCccCcceEEChhhhhhhhhheeeeeecCCCcccccc------CCCcCccccccccchhhhhhhhccCCHH
Confidence            499999999999999999999999999999888878 4864      4999999999999999999999999864


No 43 
>KOG4216|consensus
Probab=99.90  E-value=1.8e-24  Score=171.15  Aligned_cols=72  Identities=54%  Similarity=1.220  Sum_probs=67.9

Q ss_pred             CCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         38 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        38 ~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      -.+|.||||+++|.||||.+|++||+||||+-..+..|.|.+..    +|.|+..+|++|++|||+|||++||+.|
T Consensus        46 vIPCKiCGDKSSGiHYGVITCEGCKGFFRRSQ~s~a~YsCpRqk----nC~iDRtnRNRCQ~CRLqKClaLGMSRD  117 (479)
T KOG4216|consen   46 IIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNANYSCPRQK----NCLIDRTNRNRCQHCRLQKCLALGMSRD  117 (479)
T ss_pred             EEeeeeccCCCCcceeeeEeeccchHhhhhhhhccccccCCccc----CCcccccccchhhHHHHHHHHHhccchh
Confidence            35799999999999999999999999999999999999998864    7999999999999999999999999875


No 44 
>KOG4218|consensus
Probab=99.85  E-value=2.3e-22  Score=157.64  Aligned_cols=76  Identities=46%  Similarity=1.073  Sum_probs=70.2

Q ss_pred             CCCCCCCceecCCCCcceeeccccchhhHHHHHHHhhcCcccccccCCCCCCCCCCCCCCCCCCcchHHHHHHHhccCCC
Q psy16245         34 DRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD  113 (113)
Q Consensus        34 ~~~~~~~C~VCg~~~~g~hyGv~sC~aC~~FFrR~v~~~~~~~C~~~~~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~  113 (113)
                      +....+.|.||||+.+|+|||..+|+.||+||+|+|+.++.|+|....    +|.|++..|.+|.+|||+|||.+||+-|
T Consensus        11 dedl~ElCPVCGDkVSGYHYGLLTCESCKGFFKRTVQNnK~YtC~e~q----nC~iDkTqRKRCP~CRFQKCLtvGMklE   86 (475)
T KOG4218|consen   11 DEDLGELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKQYTCSEEQ----NCHIDKTQRKRCPSCRFQKCLTVGMKLE   86 (475)
T ss_pred             ccccccccccccCccccceeeeeehhhhhhHHHHHhhcCcceeccccc----ccccchHhhccCCchhHHHHhhhhhhHH
Confidence            344568999999999999999999999999999999999999998875    7999999999999999999999999754


No 45 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=69.80  E-value=1.8  Score=29.07  Aligned_cols=30  Identities=30%  Similarity=0.815  Sum_probs=21.2

Q ss_pred             CCCceecCCCCcc---eeeccccchhhHHHHHH
Q psy16245         38 DIPCKVCGDRSSG---KHYGIYSCDGCSGFFKR   67 (113)
Q Consensus        38 ~~~C~VCg~~~~g---~hyGv~sC~aC~~FFrR   67 (113)
                      +..|.-||.+...   ..||+..|..|++..|.
T Consensus        13 N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~   45 (116)
T PF01412_consen   13 NKVCADCGAPNPTWASLNYGIFLCLECAGIHRS   45 (116)
T ss_dssp             CTB-TTT-SBS--EEETTTTEEE-HHHHHHHHH
T ss_pred             cCcCCCCCCCCCCEEEeecChhhhHHHHHHHHH
Confidence            5679999987643   58999999999998665


No 46 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=59.17  E-value=7.3  Score=25.92  Aligned_cols=31  Identities=26%  Similarity=0.689  Sum_probs=25.1

Q ss_pred             CCCceecCCCCc---ceeeccccchhhHHHHHHH
Q psy16245         38 DIPCKVCGDRSS---GKHYGIYSCDGCSGFFKRS   68 (113)
Q Consensus        38 ~~~C~VCg~~~~---g~hyGv~sC~aC~~FFrR~   68 (113)
                      +..|.-|+.+..   ...||+..|..|++..|..
T Consensus         3 N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~l   36 (112)
T smart00105        3 NKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSL   36 (112)
T ss_pred             CCcccCCCCCCCCcEEeccceeEhHHhHHHHHhc
Confidence            467999987653   4699999999999997754


No 47 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=44.95  E-value=16  Score=21.08  Aligned_cols=31  Identities=23%  Similarity=0.583  Sum_probs=21.7

Q ss_pred             CCceecCCCCcc----eeecc-ccchhhHHHHHHHh
Q psy16245         39 IPCKVCGDRSSG----KHYGI-YSCDGCSGFFKRSI   69 (113)
Q Consensus        39 ~~C~VCg~~~~g----~hyGv-~sC~aC~~FFrR~v   69 (113)
                      ..|..|+...+-    ...|. ..|++|..+|++.-
T Consensus         4 ~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~   39 (52)
T smart00401        4 RSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHG   39 (52)
T ss_pred             CCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcC
Confidence            568888876543    13443 78999999998643


No 48 
>PRK00420 hypothetical protein; Validated
Probab=39.43  E-value=9.2  Score=25.95  Aligned_cols=29  Identities=24%  Similarity=0.361  Sum_probs=23.9

Q ss_pred             CCCCceecCCCCcceeeccccchhhHHHH
Q psy16245         37 LDIPCKVCGDRSSGKHYGIYSCDGCSGFF   65 (113)
Q Consensus        37 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FF   65 (113)
                      ....|.+||.+-...+-|...|-.|..+.
T Consensus        22 l~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~   50 (112)
T PRK00420         22 LSKHCPVCGLPLFELKDGEVVCPVHGKVY   50 (112)
T ss_pred             ccCCCCCCCCcceecCCCceECCCCCCee
Confidence            45789999999888788888999997654


No 49 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=34.17  E-value=33  Score=19.46  Aligned_cols=23  Identities=35%  Similarity=1.094  Sum_probs=18.4

Q ss_pred             CceecCCCCc-c-eeeccccchhhH
Q psy16245         40 PCKVCGDRSS-G-KHYGIYSCDGCS   62 (113)
Q Consensus        40 ~C~VCg~~~~-g-~hyGv~sC~aC~   62 (113)
                      .|.||+.... | .-||...|..|-
T Consensus         1 ~CiiC~~~~~~GI~I~~~fIC~~CE   25 (46)
T PF10764_consen    1 KCIICGKEKEEGIHIYGKFICSDCE   25 (46)
T ss_pred             CeEeCCCcCCCCEEEECeEehHHHH
Confidence            4899998754 6 468999999996


No 50 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=32.75  E-value=25  Score=18.64  Aligned_cols=12  Identities=25%  Similarity=0.938  Sum_probs=10.3

Q ss_pred             cchhhHHHHHHH
Q psy16245         57 SCDGCSGFFKRS   68 (113)
Q Consensus        57 sC~aC~~FFrR~   68 (113)
                      .|++|..+|++.
T Consensus        22 LCn~Cg~~~kk~   33 (36)
T PF00320_consen   22 LCNACGLYYKKY   33 (36)
T ss_dssp             EEHHHHHHHHHH
T ss_pred             HHHHHHHHHHHh
Confidence            799999998864


No 51 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=30.93  E-value=25  Score=17.79  Aligned_cols=20  Identities=35%  Similarity=0.926  Sum_probs=13.7

Q ss_pred             CceecCCCCcce-eeccccchhhH
Q psy16245         40 PCKVCGDRSSGK-HYGIYSCDGCS   62 (113)
Q Consensus        40 ~C~VCg~~~~g~-hyGv~sC~aC~   62 (113)
                      .|.||+....++ .|   .|..|.
T Consensus         2 ~C~~C~~~~~~~~~Y---~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFY---HCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCEeE---EeCCCC
Confidence            488888888887 55   455544


No 52 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.34  E-value=34  Score=19.29  Aligned_cols=13  Identities=38%  Similarity=0.664  Sum_probs=9.5

Q ss_pred             CCCCCceecCCCC
Q psy16245         36 LLDIPCKVCGDRS   48 (113)
Q Consensus        36 ~~~~~C~VCg~~~   48 (113)
                      +...+|.|||.+-
T Consensus         6 lp~K~C~~C~rpf   18 (42)
T PF10013_consen    6 LPSKICPVCGRPF   18 (42)
T ss_pred             CCCCcCcccCCcc
Confidence            4457899998763


No 53 
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=29.96  E-value=28  Score=22.78  Aligned_cols=20  Identities=35%  Similarity=0.956  Sum_probs=16.3

Q ss_pred             CCceecCCCCcceeeccccchhhHH
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSG   63 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~   63 (113)
                      ..|.+||.++++-     .|.+|..
T Consensus        81 ~~C~~CG~pss~~-----iC~~C~l  100 (104)
T TIGR00269        81 RRCERCGEPTSGR-----ICKACKF  100 (104)
T ss_pred             CcCCcCcCcCCcc-----ccHhhhh
Confidence            4699999999864     7999873


No 54 
>PHA03124 dUTPase; Provisional
Probab=29.14  E-value=33  Score=28.22  Aligned_cols=16  Identities=31%  Similarity=1.026  Sum_probs=13.1

Q ss_pred             ccchhhHHHHHHHhhc
Q psy16245         56 YSCDGCSGFFKRSIHR   71 (113)
Q Consensus        56 ~sC~aC~~FFrR~v~~   71 (113)
                      .-|-+|++||||....
T Consensus       191 ~~~~~~~~~~~~~~~~  206 (418)
T PHA03124        191 FGCMGCKAFYRRLFEC  206 (418)
T ss_pred             ccccchHHHHHHHHHH
Confidence            3599999999998654


No 55 
>PF15279 SOBP:  Sine oculis-binding protein
Probab=28.09  E-value=57  Score=25.88  Aligned_cols=14  Identities=43%  Similarity=0.816  Sum_probs=12.1

Q ss_pred             ccccccccccCCCC
Q psy16245          2 ELFVGNCRQIPPRY   15 (113)
Q Consensus         2 ~~~~~~~~~~~~~~   15 (113)
                      |||+.||+--++.-
T Consensus        73 elWl~~~~s~s~~~   86 (306)
T PF15279_consen   73 ELWLRNCRSPSPSP   86 (306)
T ss_pred             cccccccccCCCCC
Confidence            89999999887776


No 56 
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=26.75  E-value=35  Score=20.24  Aligned_cols=23  Identities=35%  Similarity=1.003  Sum_probs=18.2

Q ss_pred             CCceecCCCCc-ceeeccccchhh
Q psy16245         39 IPCKVCGDRSS-GKHYGIYSCDGC   61 (113)
Q Consensus        39 ~~C~VCg~~~~-g~hyGv~sC~aC   61 (113)
                      ..|.|||.+.. ...||...|.-|
T Consensus        17 r~C~vCg~~~gliRkygL~~CRqC   40 (54)
T PTZ00218         17 RQCRVCSNRHGLIRKYGLNVCRQC   40 (54)
T ss_pred             CeeecCCCcchhhhhcCcchhhHH
Confidence            56999999753 458998888877


No 57 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=26.45  E-value=71  Score=17.40  Aligned_cols=12  Identities=33%  Similarity=0.971  Sum_probs=9.2

Q ss_pred             ccchhhHHHHHH
Q psy16245         56 YSCDGCSGFFKR   67 (113)
Q Consensus        56 ~sC~aC~~FFrR   67 (113)
                      ..|+.|..=|++
T Consensus        24 fCC~tC~~~fk~   35 (37)
T PF08394_consen   24 FCCPTCLSQFKK   35 (37)
T ss_pred             EECHHHHHHHHh
Confidence            478999887765


No 58 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=25.82  E-value=30  Score=27.54  Aligned_cols=30  Identities=23%  Similarity=0.755  Sum_probs=25.3

Q ss_pred             CCCceecCCCCc---ceeeccccchhhHHHHHH
Q psy16245         38 DIPCKVCGDRSS---GKHYGIYSCDGCSGFFKR   67 (113)
Q Consensus        38 ~~~C~VCg~~~~---g~hyGv~sC~aC~~FFrR   67 (113)
                      +..|.-||.+.-   ...|||..|--|++..|-
T Consensus        20 Nk~CaDCga~~P~W~S~nlGvfiCi~CagvHRs   52 (319)
T COG5347          20 NKKCADCGAPNPTWASVNLGVFLCIDCAGVHRS   52 (319)
T ss_pred             cCccccCCCCCCceEecccCeEEEeecchhhhc
Confidence            568999998873   479999999999998654


No 59 
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=25.47  E-value=49  Score=19.25  Aligned_cols=28  Identities=25%  Similarity=0.724  Sum_probs=17.9

Q ss_pred             ceecCCCCcc-----eeeccccchhhHHHHHHH
Q psy16245         41 CKVCGDRSSG-----KHYGIYSCDGCSGFFKRS   68 (113)
Q Consensus        41 C~VCg~~~~g-----~hyGv~sC~aC~~FFrR~   68 (113)
                      |..|+...+-     -.=+...|++|..+++..
T Consensus         2 C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~   34 (54)
T cd00202           2 CSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKH   34 (54)
T ss_pred             CCCCCCCCCcccccCCCCcchHHHHHHHHHHhc
Confidence            5566654432     123456899999998765


No 60 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=22.64  E-value=32  Score=17.24  Aligned_cols=15  Identities=33%  Similarity=0.831  Sum_probs=5.8

Q ss_pred             CceecCCCCcc-eeec
Q psy16245         40 PCKVCGDRSSG-KHYG   54 (113)
Q Consensus        40 ~C~VCg~~~~g-~hyG   54 (113)
                      .|.+|+.+..+ ..|.
T Consensus         2 ~C~~C~~~~~~~~~Y~   17 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYR   17 (30)
T ss_dssp             --TTTS----S--EEE
T ss_pred             cCCcCCCcCCCCceEE
Confidence            47788888776 6664


No 61 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=22.36  E-value=40  Score=17.69  Aligned_cols=13  Identities=23%  Similarity=0.670  Sum_probs=8.6

Q ss_pred             CCCceecCCCCcc
Q psy16245         38 DIPCKVCGDRSSG   50 (113)
Q Consensus        38 ~~~C~VCg~~~~g   50 (113)
                      +..|.|||.+...
T Consensus        18 p~~CP~Cg~~~~~   30 (34)
T cd00729          18 PEKCPICGAPKEK   30 (34)
T ss_pred             CCcCcCCCCchHH
Confidence            4578888876543


No 62 
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=22.21  E-value=30  Score=27.40  Aligned_cols=15  Identities=33%  Similarity=0.831  Sum_probs=12.1

Q ss_pred             cccccccccCCCCCC
Q psy16245          3 LFVGNCRQIPPRYPQ   17 (113)
Q Consensus         3 ~~~~~~~~~~~~~~~   17 (113)
                      +++||++|+||=-+.
T Consensus       145 il~GDf~QlpPV~~~  159 (364)
T PF05970_consen  145 ILFGDFLQLPPVVPR  159 (364)
T ss_pred             EeehhhhhcCCCccc
Confidence            578999999986544


No 63 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=21.97  E-value=36  Score=22.60  Aligned_cols=27  Identities=22%  Similarity=0.578  Sum_probs=20.6

Q ss_pred             CCceecCCCCcceeeccccchhhHHHH
Q psy16245         39 IPCKVCGDRSSGKHYGIYSCDGCSGFF   65 (113)
Q Consensus        39 ~~C~VCg~~~~g~hyGv~sC~aC~~FF   65 (113)
                      ..|.||++......=+.+.|.+|..-|
T Consensus        36 daCeiC~~~GY~q~g~~lvC~~C~~~~   62 (102)
T PF10080_consen   36 DACEICGPKGYYQEGDQLVCKNCGVRF   62 (102)
T ss_pred             EeccccCCCceEEECCEEEEecCCCEE
Confidence            469999877766666788999997543


No 64 
>PRK12495 hypothetical protein; Provisional
Probab=20.89  E-value=33  Score=26.06  Aligned_cols=29  Identities=24%  Similarity=0.452  Sum_probs=23.2

Q ss_pred             CCCCceecCCCCcceeeccccchhhHHHHH
Q psy16245         37 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFK   66 (113)
Q Consensus        37 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFr   66 (113)
                      +...|.+||.+...+ =|+..|-.|...+-
T Consensus        41 sa~hC~~CG~PIpa~-pG~~~Cp~CQ~~~~   69 (226)
T PRK12495         41 TNAHCDECGDPIFRH-DGQEFCPTCQQPVT   69 (226)
T ss_pred             chhhcccccCcccCC-CCeeECCCCCCccc
Confidence            456899999999843 69999999986554


No 65 
>KOG0703|consensus
Probab=20.26  E-value=35  Score=26.86  Aligned_cols=30  Identities=23%  Similarity=0.756  Sum_probs=24.8

Q ss_pred             CCCceecCCCCc---ceeeccccchhhHHHHHH
Q psy16245         38 DIPCKVCGDRSS---GKHYGIYSCDGCSGFFKR   67 (113)
Q Consensus        38 ~~~C~VCg~~~~---g~hyGv~sC~aC~~FFrR   67 (113)
                      +..|.-||...-   ..++||+.|-.|.+..|.
T Consensus        25 N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~   57 (287)
T KOG0703|consen   25 NKVCADCGAKGPRWASWNLGVFICLRCAGIHRS   57 (287)
T ss_pred             cCcccccCCCCCCeEEeecCeEEEeeccccccc
Confidence            567999998763   479999999999988654


No 66 
>PF00357 Integrin_alpha:  Integrin alpha cytoplasmic region;  InterPro: IPR018184 Some alpha subunits are cleaved post- translationally to produce a heavy and a light chain linked by a disulphide bond [, ]. Integrin alpha chains share a conserved sequence which is found at the beginning of the cytoplasmic domain, just after the end of the transmembrane region. Within the N-terminal domain of alpha subunits, seven sequence repeats, each of approximately 60 amino acids, have been found []. It has been predicted that these repeats assume the beta-propeller fold. The domains contain seven four-stranded beta-sheets arranged in a torus around a pseudosymmetry axis []. Integrin ligands and a putative Mg2+ ion are predicted to bind to the upper face of the propeller, in a manner analogous to the way in which the trimeric G-protein beta subunit (G beta) (which also has a beta-propeller fold) binds the G protein alpha subunit []. Integrin cytoplasmic domains are normally less than 50 amino acids in length, with the beta-subunit sequences exhibiting greater homology to each other than the alpha-subunit sequences []. This is consistent with current evidence that the beta subunit is the principal site for binding of cytoskeletal and signalling molecules, whereas the alpha subunit has a regulatory role. The first ten residues of the alpha-subunit cytoplasmic domain appear to form an alpha helix that is terminated by a proline residue. The remainder of the domain is highly acidic in nature and this loops back to contact the membrane-proximal lysine anchor residue. This entry represents the conserved site of the C-terminal integrin alpha chain. ; PDB: 2LKJ_A 2LKE_A 2K8O_A 1DPK_A 2K9J_A 1DPQ_A 1S4W_A 1M8O_A 2K1A_A 2KNC_A ....
Probab=20.18  E-value=46  Score=14.62  Aligned_cols=9  Identities=56%  Similarity=0.899  Sum_probs=6.4

Q ss_pred             HHHHHHhhc
Q psy16245         63 GFFKRSIHR   71 (113)
Q Consensus        63 ~FFrR~v~~   71 (113)
                      +||.|....
T Consensus         3 GFFKR~~~~   11 (15)
T PF00357_consen    3 GFFKRQRPP   11 (15)
T ss_dssp             CHHHHHHHH
T ss_pred             ccccccCcc
Confidence            589987543


Done!