BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy16269
         (186 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BOL|A Chain A, Crystal Structure And Assembly Of Tsp36, A Metazoan Small
           Heat Shock Protein
 pdb|2BOL|B Chain B, Crystal Structure And Assembly Of Tsp36, A Metazoan Small
           Heat Shock Protein
          Length = 314

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 11/64 (17%)

Query: 48  LKLRFDVSQYQPEEIVVKTVDNKLLV---------STLTTKTQIRCEPIPARRDRSQNRR 98
            K+ F+V  ++ EEI +K   NKL+V             +++  R  P+P   DR  N  
Sbjct: 114 FKVYFNVKNFKAEEITIKADKNKLVVRAQKSVACGDAAMSESVGRSIPLPPSVDR--NHI 171

Query: 99  QQTI 102
           Q TI
Sbjct: 172 QATI 175


>pdb|2A4A|A Chain A, Deoxyribose-Phosphate Aldolase From P. Yoelii
 pdb|2A4A|B Chain B, Deoxyribose-Phosphate Aldolase From P. Yoelii
          Length = 281

 Score = 26.9 bits (58), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 45  NKLLKLRFDVSQYQPEEIVVKTV-----DNKLLVSTLTTKTQIRCEP 86
           NK+LK+  +V + + E++++KT       N   + T T K QI   P
Sbjct: 156 NKILKVIIEVGELKTEDLIIKTTLAVLNGNADFIKTSTGKVQINATP 202


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.134    0.373 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,684,866
Number of Sequences: 62578
Number of extensions: 162689
Number of successful extensions: 155
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 153
Number of HSP's gapped (non-prelim): 4
length of query: 186
length of database: 14,973,337
effective HSP length: 93
effective length of query: 93
effective length of database: 9,153,583
effective search space: 851283219
effective search space used: 851283219
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 48 (23.1 bits)