BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy16308
(371 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane
Monoxygenase 139-3
pdb|3CBD|B Chain B, Directed Evolution Of Cytochrome P450 Bm3, To Octane
Monoxygenase 139-3
Length = 455
Score = 28.5 bits (62), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
Query: 219 SFREQIHKMHKSIALATRADREANGKRRPHLNTR--KGEEEEENRKFPDYNLSYRVILVL 276
F+E I K+ + ADR+A+G++ L T+ G++ E D N+SY++I L
Sbjct: 204 QFQEDI-KVMNDLVDKIIADRKASGEQSDDLLTQMLNGKDPETGEPLDDGNISYQIITFL 262
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.138 0.433
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,177,913
Number of Sequences: 62578
Number of extensions: 380600
Number of successful extensions: 927
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 925
Number of HSP's gapped (non-prelim): 3
length of query: 371
length of database: 14,973,337
effective HSP length: 100
effective length of query: 271
effective length of database: 8,715,537
effective search space: 2361910527
effective search space used: 2361910527
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)