Diaphorina citri psyllid: psy16312

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MCDNCESILSQAEPPEDTEVIYEKKFVDEEHLPFAENSVDLLISNLALHWVNNLPGCFQQVLKCLRQDGVFLASIFGGETLYELRSAVHLAEMERRGGVASHISPFTQIRDVGSLLTRAGFNMLTIDVDEIVIHYPSMFELMWDLKGMGESNACVNRSLHFPLELQYASAAIYEKYYGKPNDDKNGGGTCVPATFQIIYLVAWKPDPSQPKPLKRGSGEVSLKDLHRIDDIAKQKGFIKVDEDKD
cccccHHHHHHHcccccccccccEEEcccccccccccccHHEEEccHHHHcccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccEEEEEEEEEEEcccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccccccCEEEEEEEEEEEECccccccccccccccCEECHHHHHcccHHHccccccccccccc
MCDNCESILSQAEPPEDTEVIYEKKFVDEEHLPFAENSVDLLISNLALHWVNNLPGCFQQVLKCLRQDGVFLASIFGGETLYELRSAVHLAEMERRGGVASHISPFTQIRDVGSLLTRAGFNMLTIDVDEIVIHYPSMFELMWDLKGMGESNACVNRSLHFPLELQYASAAIYEKYYGKPNDDKNGGGTCVPATFQIIYLVAWK*****************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDNCESILSQAEPPEDTEVIYEKKFVDEEHLPFAENSVDLLISNLALHWVNNLPGCFQQVLKCLRQDGVFLASIFGGETLYELRSAVHLAEMERRGGVASHISPFTQIRDVGSLLTRAGFNMLTIDVDEIVIHYPSMFELMWDLKGMGESNACVNRSLHFPLELQYASAAIYEKYYGKPNDDKNGGGTCVPATFQIIYLVAWKPDPSQPKPLKRGSGEVSLKDLHRIDDIAKQKGFIKVDEDKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 Putative methyltransferase involved in mitochondrial complex I assembly at early stages.confidentA3KP37
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 Putative methyltransferase involved in mitochondrial complex I assembly at early stages.confidentQ5RBS1
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 Putative methyltransferase involved in mitochondrial complex I assembly at early stages.confidentA2APY7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031314 [CC]extrinsic to mitochondrial inner membraneprobableGO:0044464, GO:0019898, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0031312, GO:0031975, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0008168 [MF]methyltransferase activityprobableGO:0003824, GO:0016740, GO:0016741, GO:0003674
GO:0032981 [BP]mitochondrial respiratory chain complex I assemblyprobableGO:0006996, GO:0033108, GO:0044699, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0097031, GO:0006461, GO:0010257, GO:0016043, GO:0065003, GO:0044085, GO:0044763, GO:0071840, GO:0034622, GO:0008150, GO:0009987, GO:0043623, GO:0007005

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BKW, chain A
Confidence level:very confident
Coverage over the Query: 2-77
View the alignment between query and template
View the model in PyMOL
Template: 2YQZ, chain A
Confidence level:confident
Coverage over the Query: 2-204
View the alignment between query and template
View the model in PyMOL