RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16320
         (214 letters)



>gnl|CDD|192735 pfam11282, DUF3082, Protein of unknown function (DUF3082).  This
          family of proteins has no known function.
          Length = 82

 Score = 26.8 bits (60), Expect = 3.2
 Identities = 10/40 (25%), Positives = 14/40 (35%)

Query: 15 PGKVHFLLGADEEQNQGLVSYTMPQGEVKTFDSHSAHSSS 54
           G +  L GA        + Y +       F +   HSSS
Sbjct: 2  KGPLSCLSGALTSGLLAWLLYFLSSSIATYFAAKPPHSSS 41


>gnl|CDD|239648 cd03676, Nudix_hydrolase_3, Members of the Nudix hydrolase
           superfamily catalyze the hydrolysis of NUcleoside
           DIphosphates linked to other moieties, X. Enzymes belong
           to this superfamily requires a divalent cation, such as
           Mg2+ or Mn2+, for their activity and contain a highly
           conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where
           U = I, L or V), which functions as a metal binding and
           catalytic site. Substrates of nudix hydrolases include
           intact and oxidatively damaged nucleoside triphosphates,
           dinucleoside polyphosphates, nucleotide-sugars and
           dinucleotide enzymes. These substrates are metabolites
           or cell signaling molecules that require regulation
           during different stages of the cell cycle or during
           periods of stress. In general, the role of the nudix
           hydrolase is to sanitize the nucleotide pools and to
           maintain cell viability, thereby serving as surveillance
           & "house-cleaning" enzymes. Substrate specificity is
           used to define families within the superfamily.
           Differences in substrate specificity are determined by
           the N-terminal extension or by residues in variable loop
           regions. Mechanistically, substrate hydrolysis occurs by
           a nucleophilic substitution reaction, with variation in
           the numbers and roles of divalent cations required.
          Length = 180

 Score = 27.6 bits (62), Expect = 3.4
 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%)

Query: 103 GWRNESFP-YGKPVEMVFEFDR 123
           GWRNE +  YG   E +FE +R
Sbjct: 1   GWRNELYAVYGPFGEPLFEIER 22


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0754    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 10,824,060
Number of extensions: 979514
Number of successful extensions: 654
Number of sequences better than 10.0: 1
Number of HSP's gapped: 654
Number of HSP's successfully gapped: 6
Length of query: 214
Length of database: 10,937,602
Length adjustment: 93
Effective length of query: 121
Effective length of database: 6,812,680
Effective search space: 824334280
Effective search space used: 824334280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (25.7 bits)