Diaphorina citri psyllid: psy16320


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
GKVHFLLGADEEQNPGKVHFLLGADEEQNQGLVSYTMPQGEVKTFDSHSAHSSSLDLTDKTYDGVVEDGLLSGGLGQLTDGQIGADNFKMDAKSRNKGYEWIGWRNESFPYGKPVEMVFEFDRVRNFTAMHLHINNYYSKDIQVFSHANVYLSLGGRQFSLEPIQFTYMPDTIMEKARNVTIKLHHKQAKYLKLQMYFSNKWLLISEIMFQSVQ
ccEEEEEccccccccCEEEEEEcccccccccEEEEccccccCECcccccccccccEEEECccccCCcccCECccCCcCCcccccccccccccccccccccEEEEccccccccccEEEEEEEcEEEEEEEEEEEEEccccccccEEEEEEEEEEccccccccccEEECccccccccccEEEEEEcccccccEEEEEEEEcccEEEEEEEEEEEcc
GKVHFLLGADEEQNPGKVHFLLGADEEQNQGLVSYTMPQGEVKTFDSHSAHSSSLDLTDKTYDGVVEDGLLSGGLGQLTDGQIGADNFKMDAKSRNKGYEWIGWRNESFPYGKPVEMVFEFDRVRNFTAMHLHINNYYSKDIQVFSHANVYLSLGGRQFSLEPIQFTYMPDTIMEKARNVTIKLHHKQAKYLKLQMYFSNKWLLISEIMFQS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GKVHFLLGADEEQNPGKVHFLLGADEEQNQGLVSYTMPQGEVKTFDSHSAHSSSLDLTDKTYDGVVEDGLLSGGLGQLTDGQIGADNFKMDAKSRNKGYEWIGWRNESFPYGKPVEMVFEFDRVRNFTAMHLHINNYYSKDIQVFSHANVYLSLGGRQFSLEPIQFTYMPDTIMEKARNVTIKLHHKQAKYLKLQMYFSNKWLLISEIMFQSVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AG4, chain A
Confidence level:very confident
Coverage over the Query: 9-213
View the alignment between query and template
View the model in PyMOL