BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy16324
         (251 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase From Borrelia Burgdorferi
 pdb|3HJA|B Chain B, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase From Borrelia Burgdorferi
 pdb|3HJA|C Chain C, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase From Borrelia Burgdorferi
 pdb|3HJA|D Chain D, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase From Borrelia Burgdorferi
          Length = 356

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 21/43 (48%)

Query: 78  TIMADYEAEPVTCNISRHDINLGISNCNWASCREGCTAQMIKC 120
           T+ A  E + +   ++ HDIN  +   + ASC   C A + K 
Sbjct: 143 TVPAKDEIKTIVLGVNDHDINSDLKAVSNASCTTNCLAPLAKV 185


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.454 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,941,682
Number of Sequences: 62578
Number of extensions: 199487
Number of successful extensions: 214
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 213
Number of HSP's gapped (non-prelim): 3
length of query: 251
length of database: 14,973,337
effective HSP length: 96
effective length of query: 155
effective length of database: 8,965,849
effective search space: 1389706595
effective search space used: 1389706595
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)