Query         psy16324
Match_columns 251
No_of_seqs    60 out of 62
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 18:28:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16324.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16324hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03185 CaKB:  Calcium-activat  99.9   1E-26 2.3E-31  203.9   0.0  174   36-245    11-195 (201)
  2 PF15102 TMEM154:  TMEM154 prot  69.9     1.5 3.3E-05   37.9   0.1   35  215-249    55-92  (146)
  3 PF12158 DUF3592:  Protein of u  68.3      21 0.00045   28.1   6.3   21  186-206    93-113 (148)
  4 PF04281 Tom22:  Mitochondrial   66.6      12 0.00027   31.9   4.9   16   58-73     96-111 (137)
  5 PF09026 CENP-B_dimeris:  Centr  60.8     4.8  0.0001   33.1   1.4   12    7-18     10-21  (101)
  6 TIGR00986 3a0801s05tom22 mitoc  59.7      27 0.00059   30.4   5.8   17   58-74     94-110 (145)
  7 PF02724 CDC45:  CDC45-like pro  59.5      10 0.00023   38.8   3.8   39   51-89    238-279 (622)
  8 PF08372 PRT_C:  Plant phosphor  59.4      13 0.00029   32.3   3.9   16   57-72    103-118 (156)
  9 PF09026 CENP-B_dimeris:  Centr  57.9       7 0.00015   32.2   1.8   12   48-59     59-70  (101)
 10 PF07234 DUF1426:  Protein of u  54.9      21 0.00045   29.8   4.1   40   40-79     10-49  (117)
 11 PF10642 Tom5:  Mitochondrial i  53.2     8.4 0.00018   27.8   1.4   17   57-73     27-43  (49)
 12 PF10577 UPF0560:  Uncharacteri  51.8      14 0.00031   39.5   3.4   33  216-248   273-306 (807)
 13 PF10587 EF-1_beta_acid:  Eukar  49.9     2.6 5.6E-05   27.5  -1.5   18   16-33      5-22  (28)
 14 PF14812 PBP1_TM:  Transmembran  46.3     4.3 9.4E-05   32.1  -1.0    8   61-68     70-77  (81)
 15 PF05915 DUF872:  Eukaryotic pr  45.2      65  0.0014   26.6   5.6    7    8-14      4-10  (115)
 16 PF10329 DUF2417:  Region of un  44.7      29 0.00063   32.0   3.9   43   22-66    155-198 (232)
 17 PF02038 ATP1G1_PLM_MAT8:  ATP1  43.6      15 0.00032   26.9   1.4   37  207-246     8-44  (50)
 18 KOG2140|consensus               42.9     7.1 0.00015   40.7  -0.4   20    9-28    414-433 (739)
 19 PF06024 DUF912:  Nucleopolyhed  42.4      20 0.00044   28.5   2.2   29   42-70     55-83  (101)
 20 PF04931 DNA_pol_phi:  DNA poly  39.1      21 0.00046   37.2   2.3   12   72-83    737-748 (784)
 21 PF05510 Sarcoglycan_2:  Sarcog  37.4      33 0.00073   33.9   3.3   27  215-241   283-309 (386)
 22 KOG1307|consensus               36.8      14  0.0003   38.0   0.6   27   47-75    424-450 (588)
 23 TIGR01195 oadG_fam sodium pump  36.3      83  0.0018   24.4   4.7   41   46-87      3-44  (82)
 24 PF00283 Cytochrom_B559:  Cytoc  36.0      29 0.00063   22.9   1.8   14  216-229    15-28  (29)
 25 COG3736 VirB8 Type IV secretor  35.8      25 0.00054   32.6   2.0   27   44-70     41-67  (239)
 26 TIGR00927 2A1904 K+-dependent   33.7      21 0.00045   39.4   1.3   21   46-66    932-952 (1096)
 27 PF04246 RseC_MucC:  Positive r  33.2 1.7E+02  0.0038   23.6   6.3   49  189-237    42-91  (135)
 28 PTZ00415 transmission-blocking  32.0      22 0.00047   41.9   1.1   11  189-199   453-463 (2849)
 29 PTZ00415 transmission-blocking  31.0      24 0.00052   41.5   1.2   15   31-45    187-201 (2849)
 30 PRK02919 oxaloacetate decarbox  30.9 1.1E+02  0.0023   24.0   4.6   43   46-89      6-48  (82)
 31 PF08627 CRT-like:  CRT-like;    30.8 1.2E+02  0.0025   26.2   5.0   20   31-50     29-48  (130)
 32 PRK13872 conjugal transfer pro  29.8      69  0.0015   28.4   3.7   27   44-70     39-65  (228)
 33 PF11368 DUF3169:  Protein of u  29.5      56  0.0012   29.2   3.2   23   44-66     97-119 (248)
 34 TIGR00964 secE_bact preprotein  28.9      91   0.002   22.1   3.5   34   29-66     11-44  (55)
 35 COG4038 Predicted membrane pro  28.5      34 0.00074   27.3   1.4   32   44-79      5-36  (87)
 36 KOG1832|consensus               28.5      25 0.00055   39.0   0.9   20   11-30   1407-1426(1516)
 37 PF03248 Rer1:  Rer1 family;  I  28.2      81  0.0018   28.1   3.8   31   33-63     97-128 (176)
 38 COG3630 OadG Na+-transporting   27.3 1.3E+02  0.0029   24.1   4.5   40   49-89      9-48  (84)
 39 PF12911 OppC_N:  N-terminal TM  27.3 1.3E+02  0.0028   20.6   4.0   38   40-80     11-49  (56)
 40 PRK13865 type IV secretion sys  27.2      72  0.0015   29.0   3.4   25   46-70     40-64  (229)
 41 KOG2262|consensus               26.8      63  0.0014   34.6   3.3   34  145-178   196-230 (761)
 42 TIGR02976 phageshock_pspB phag  26.5      64  0.0014   25.0   2.6   17  219-235     4-20  (75)
 43 PRK13887 conjugal transfer pro  25.9      86  0.0019   28.4   3.7   25   46-70     55-79  (250)
 44 PF14816 FAM178:  Family of unk  25.5      40 0.00087   33.2   1.6   24  110-133   135-158 (377)
 45 KOG0772|consensus               24.6      37  0.0008   35.4   1.2    8    6-13    123-130 (641)
 46 PF11947 DUF3464:  Protein of u  24.0 1.5E+02  0.0032   25.9   4.6   38   30-68     49-87  (153)
 47 PF11712 Vma12:  Endoplasmic re  23.9 1.7E+02  0.0037   24.2   4.8   31   49-79     79-114 (142)
 48 PF14143 YrhC:  YrhC-like prote  23.3 1.7E+02  0.0037   22.7   4.3   42   40-81      2-44  (72)
 49 PRK02561 psbF cytochrome b559   23.3      20 0.00043   25.6  -0.7   19  216-234    20-38  (44)
 50 TIGR00939 2a57 Equilibrative N  22.9 1.3E+02  0.0028   29.4   4.5   15   35-49    261-275 (437)
 51 PF02532 PsbI:  Photosystem II   22.8 1.2E+02  0.0026   20.9   3.0   16   57-75     14-29  (36)
 52 PHA02831 EEV host range protei  22.8      54  0.0012   30.7   1.9   44  206-250   222-265 (268)
 53 TIGR02120 GspF general secreti  22.7   2E+02  0.0042   27.1   5.5   23  216-238   363-385 (399)
 54 PRK07597 secE preprotein trans  22.7 1.4E+02   0.003   21.7   3.6   34   29-66     20-53  (64)
 55 COG3872 Predicted metal-depend  22.5      74  0.0016   30.7   2.7   27   49-77    105-131 (318)
 56 PHA02954 EEV membrane glycopro  22.5      14  0.0003   35.3  -2.1   27  210-236   274-300 (317)
 57 PF11271 DUF3068:  Protein of u  22.4      75  0.0016   29.4   2.7   36   50-86      4-39  (301)
 58 PF10446 DUF2457:  Protein of u  21.6      49  0.0011   33.5   1.4   17   92-108   141-157 (458)
 59 PRK13553 fumarate reductase cy  21.5 1.4E+02  0.0031   28.1   4.3   30   38-67    203-232 (258)
 60 PF02487 CLN3:  CLN3 protein;    21.5 2.1E+02  0.0045   28.3   5.6   40   35-78    229-268 (402)
 61 TIGR01333 cyt_b559_beta cytoch  21.5      19 0.00041   25.6  -1.1   19  216-234    19-37  (43)
 62 PLN02601 beta-carotene hydroxy  21.1      69  0.0015   30.9   2.2   23   42-64     91-113 (303)
 63 CHL00039 psbF photosystem II p  20.8      21 0.00045   24.9  -1.0   18  217-234    16-33  (39)
 64 COG5533 UBP5 Ubiquitin C-termi  20.4      42 0.00091   33.2   0.6   13  237-249   284-296 (415)
 65 PF02439 Adeno_E3_CR2:  Adenovi  20.3      55  0.0012   22.8   1.0   24  224-247    10-33  (38)
 66 KOG1792|consensus               20.3 1.1E+02  0.0023   28.2   3.2   31   48-78    164-195 (230)

No 1  
>PF03185 CaKB:  Calcium-activated potassium channel, beta subunit;  InterPro: IPR003930 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Ca2+-activated K+ channels are a diverse group of channels that are activated by an increase in intracellular Ca2+ concentration. They are found in the majority of nerve cells, where they modulate cell excitability and action potential. Three types of Ca2+-activated K+ channel have been characterised, termed small-conductance (SK), intermediate conductance (IK) and large conductance (BK) respectively []. BK channels (also referred to as maxi-K channels) are widely expressed in the body, being found in glandular tissue, smooth and skeletal muscle, as well as in neural tissues. They have been demonstrated to regulate arteriolar and airway diameter, and also neurotransmitter release. Each channel complex is thought to be composed of 2 types of subunit: the pore- forming (alpha) subunits and smaller accessory (beta) subunits.  The beta subunit (which is thought to possess 2 TM domains) increases the Ca2+ sensitivity of the BK channel []. It does this by enhancing the time spent by the channel in burst-like open states. However, it has little effect on the durations of closed intervals between bursts, or on the numbers of open and closed states entered during gating []. ; GO: 0015269 calcium-activated potassium channel activity, 0006813 potassium ion transport, 0016020 membrane; PDB: 1JO6_A.
Probab=99.92  E-value=1e-26  Score=203.88  Aligned_cols=174  Identities=21%  Similarity=0.440  Sum_probs=0.4

Q ss_pred             chhhHHHHHhhhhHHHHHHHHHHHHHHHHHhhhhhhhchhHHHHhhcCCCcceeeeeeeeeecCCCcCCccccccccccc
Q psy16324         36 PEEQTTLQKAKFYVSLCSGVTACLSAFAFLFLIPFIIEPAIKTIMADYEAEPVTCNISRHDINLGISNCNWASCREGCTA  115 (251)
Q Consensus        36 p~~~t~~ek~~FYttl~l~~tavlSlfafLFLvPfvvdPAisti~~~f~~~Pv~C~tt~~~~~~G~~NCtWsSCREGCTs  115 (251)
                      -|+|.++      +++.+++.|++++|.+++.   |+-|++...+    .++++||+....+.....+|+. ||+-.|.+
T Consensus        11 gedrai~------lg~~m~~~svlm~~vlGit---iv~P~l~s~~----~~et~Ctvl~s~i~~~~v~Cs~-~cg~~c~~   76 (201)
T PF03185_consen   11 GEDRAIL------LGFAMMICSVLMLFVLGIT---IVKPYLKSLW----FEETNCTVLSSHIVGEWVDCSF-SCGSDCRG   76 (201)
T ss_dssp             S-------------------------------------------------------------------------------
T ss_pred             cchHHHH------HHHHHHHHHHHHHHHHHHh---ccchhhhhcc----cccceEEEEEEEeecccccccc-cCCCCCCC
Confidence            3467888      8888899999999999997   9999999866    5899999999999988899999 99999998


Q ss_pred             Cc-ccceEEEEEeeccchhcccccCCCCCCCCcccccEEeeccCCCCCCCCCc---hh------HHHHHhCCCCCCCCCC
Q psy16324        116 QM-IKCHQISVHYSRMFFKDYNKSHSPGPIPWDHEDIRFLINTEGCGYPPGTN---CT------NFVKQYGLPESPSQKS  185 (251)
Q Consensus       116 ~~-y~C~QI~Vnys~~~~~~~~~~~~~~~~~w~~~esrLliN~kGCgypP~~n---Ck------~F~~~YG~dg~~~~~~  185 (251)
                      .+ |+|.||+|||+.+.-..          ..+.+|..+..|.| |.|+|++.   -+      +|.+.||..       
T Consensus        77 ~s~yPCLqV~Vn~t~sg~~a----------~L~~~E~~l~~n~k-CsY~P~C~~d~~~~~~~V~~~~~~~~~~-------  138 (201)
T PF03185_consen   77 VSKYPCLQVFVNYTHSGQTA----------LLHHDEETLDSNPK-CSYIPKCHRDRQDNRAEVEDFQENFGQQ-------  138 (201)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cCCCCceEEEEEecCCCceE----------EEEEchHhhccCCc-ceecCcccccHHHHHHHHHHHHHHhhhc-------
Confidence            88 99999999998755433          77889999999999 99999641   11      366666633       


Q ss_pred             CCCCcceeeeeCCC-CCceeEEecchhhhHHHHHHHhhhhHHHHHHHHHhhhhhccCCcCC
Q psy16324        186 SPPKPFPCYYSKVF-PTLHVVAKYNWDDNLRYLILALVVPIVLFFGSLTILGYWYCPRKSK  245 (251)
Q Consensus       186 ~aga~FPCYYSr~~-p~~~Vvar~d~d~t~~~Li~a~~VP~vlFvvS~i~L~~~~C~~~~k  245 (251)
                       +|++|||||++.+ |+. ||.+...+..  .++|+|+||.++|+++++++.+..|.+.+-
T Consensus       139 -~gq~f~Cfy~P~~~~~~-Vil~r~y~~~--~~fhslfWP~l~lvgG~liv~mvk~~q~ls  195 (201)
T PF03185_consen  139 -NGQTFPCFYDPDNQPED-VILRRKYDPS--VLFHSLFWPSLMLVGGVLIVAMVKLTQYLS  195 (201)
T ss_dssp             -------------------------------------------------------------
T ss_pred             -cCcceeeeecCCCCcce-EEEEEecCHh--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence             4899999999995 688 9989888888  699999999999999999999999987543


No 2  
>PF15102 TMEM154:  TMEM154 protein family
Probab=69.88  E-value=1.5  Score=37.92  Aligned_cols=35  Identities=29%  Similarity=0.568  Sum_probs=23.8

Q ss_pred             HHHHHHhhhhHHHH---HHHHHhhhhhccCCcCCCCCC
Q psy16324        215 RYLILALVVPIVLF---FGSLTILGYWYCPRKSKVQPA  249 (251)
Q Consensus       215 ~~Li~a~~VP~vlF---vvS~i~L~~~~C~~~~k~~~~  249 (251)
                      .+||+..+||.||+   ++++++|++.|+.+-.|.+|+
T Consensus        55 ~efiLmIlIP~VLLvlLLl~vV~lv~~~kRkr~K~~~s   92 (146)
T PF15102_consen   55 LEFILMILIPLVLLVLLLLSVVCLVIYYKRKRTKQEPS   92 (146)
T ss_pred             cceEEEEeHHHHHHHHHHHHHHHheeEEeecccCCCCc
Confidence            35688889996655   556777777776666666553


No 3  
>PF12158 DUF3592:  Protein of unknown function (DUF3592);  InterPro: IPR021994  This family of proteins is functionally uncharacterised.This family of proteins is found in bacteria, archaea, eukaryotes and viruses. Proteins in this family are typically between 150 and 242 amino acids in length. 
Probab=68.33  E-value=21  Score=28.10  Aligned_cols=21  Identities=14%  Similarity=0.181  Sum_probs=17.7

Q ss_pred             CCCCcceeeeeCCCCCceeEE
Q psy16324        186 SPPKPFPCYYSKVFPTLHVVA  206 (251)
Q Consensus       186 ~aga~FPCYYSr~~p~~~Vva  206 (251)
                      ..|+.-+-||++++|+.+++.
T Consensus        93 ~~G~~V~V~Y~P~~P~~~~l~  113 (148)
T PF12158_consen   93 PIGDTVTVYYNPNNPEEARLE  113 (148)
T ss_pred             CCcCEEEEEECCcCCCeEEEe
Confidence            357899999999999996665


No 4  
>PF04281 Tom22:  Mitochondrial import receptor subunit Tom22 ;  InterPro: IPR005683  The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family represents the Tom22 proteins []. The N-terminal region of Tom22 has been shown to have chaperone-like activity, and the C-terminal region faces the intermembrane face []. ; GO: 0006886 intracellular protein transport, 0005741 mitochondrial outer membrane
Probab=66.65  E-value=12  Score=31.89  Aligned_cols=16  Identities=25%  Similarity=0.507  Sum_probs=10.8

Q ss_pred             HHHHHHHHhhhhhhhc
Q psy16324         58 CLSAFAFLFLIPFIIE   73 (251)
Q Consensus        58 vlSlfafLFLvPfvvd   73 (251)
                      |++-.++|..+|+++.
T Consensus        96 i~tTSallLgvPl~l~  111 (137)
T PF04281_consen   96 IVTTSALLLGVPLALE  111 (137)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4455567777888874


No 5  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=60.84  E-value=4.8  Score=33.11  Aligned_cols=12  Identities=50%  Similarity=0.615  Sum_probs=0.0

Q ss_pred             hhccCCCCCCCc
Q psy16324          7 KLQNSDKDEDSE   18 (251)
Q Consensus         7 ~~~~~~~~~~~~   18 (251)
                      +-+++|+|||.+
T Consensus        10 ~dse~dsdEdee   21 (101)
T PF09026_consen   10 EDSESDSDEDEE   21 (101)
T ss_dssp             ------------
T ss_pred             cccccccccchh
Confidence            345566655443


No 6  
>TIGR00986 3a0801s05tom22 mitochondrial import receptor subunit Tom22. translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tom22 proteins.
Probab=59.74  E-value=27  Score=30.39  Aligned_cols=17  Identities=35%  Similarity=0.503  Sum_probs=12.1

Q ss_pred             HHHHHHHHhhhhhhhch
Q psy16324         58 CLSAFAFLFLIPFIIEP   74 (251)
Q Consensus        58 vlSlfafLFLvPfvvdP   74 (251)
                      |+|-.+||.-||+++.=
T Consensus        94 ivsTSaLLLgVPlala~  110 (145)
T TIGR00986        94 AVSTSALLLGVPFAISF  110 (145)
T ss_pred             hhHHHHHHHHHHHHHHH
Confidence            45666777888988753


No 7  
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=59.46  E-value=10  Score=38.84  Aligned_cols=39  Identities=5%  Similarity=0.025  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhh---chhHHHHhhcCCCccee
Q psy16324         51 LCSGVTACLSAFAFLFLIPFII---EPAIKTIMADYEAEPVT   89 (251)
Q Consensus        51 l~l~~tavlSlfafLFLvPfvv---dPAisti~~~f~~~Pv~   89 (251)
                      ||++++|+.+.++.--.-+-.+   -|.++.-.+.+.|.+..
T Consensus       238 LW~AIvGlT~q~i~~~i~~~~Y~~~~~~L~~eV~rl~~~~~~  279 (622)
T PF02724_consen  238 LWLAIVGLTDQYIHERISSERYDRYVPLLQDEVSRLNPSNDS  279 (622)
T ss_pred             HHHHHHhhhHHhhhcccchhhHHHHHHHHHHHHHhcCCcccc
Confidence            5677777777777443333222   36667777777666644


No 8  
>PF08372 PRT_C:  Plant phosphoribosyltransferase C-terminal;  InterPro: IPR013583 This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins. It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains (IPR000008 from INTERPRO). 
Probab=59.45  E-value=13  Score=32.29  Aligned_cols=16  Identities=38%  Similarity=0.874  Sum_probs=9.4

Q ss_pred             HHHHHHHHHhhhhhhh
Q psy16324         57 ACLSAFAFLFLIPFII   72 (251)
Q Consensus        57 avlSlfafLFLvPfvv   72 (251)
                      +.+...+.+++||+-+
T Consensus       103 ~clv~avvly~vP~r~  118 (156)
T PF08372_consen  103 FCLVAAVVLYFVPFRV  118 (156)
T ss_pred             HHHHHHHHHHHhhHHH
Confidence            4455555677777743


No 9  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=57.92  E-value=7  Score=32.19  Aligned_cols=12  Identities=8%  Similarity=-0.020  Sum_probs=4.1

Q ss_pred             hHHHHHHHHHHH
Q psy16324         48 YVSLCSGVTACL   59 (251)
Q Consensus        48 Yttl~l~~tavl   59 (251)
                      |+|++.+.-.+.
T Consensus        59 YltSf~id~~v~   70 (101)
T PF09026_consen   59 YLTSFPIDDKVQ   70 (101)
T ss_dssp             HHCTS---HHHH
T ss_pred             hhhccchhHhhh
Confidence            455554444433


No 10 
>PF07234 DUF1426:  Protein of unknown function (DUF1426);  InterPro: IPR009871 This family consists of several Banana bunchy top virus proteins of around 120 residues in length. Q9IGU4 from SWISSPROT is annotated a movement protein whereas most other family members are hypothetical. The function of this family is unknown.
Probab=54.91  E-value=21  Score=29.84  Aligned_cols=40  Identities=18%  Similarity=0.291  Sum_probs=33.9

Q ss_pred             HHHHHhhhhHHHHHHHHHHHHHHHHHhhhhhhhchhHHHH
Q psy16324         40 TTLQKAKFYVSLCSGVTACLSAFAFLFLIPFIIEPAIKTI   79 (251)
Q Consensus        40 t~~ek~~FYttl~l~~tavlSlfafLFLvPfvvdPAisti   79 (251)
                      -+.|-++|+..+|.+++-+--+.++||=||-+|---++-+
T Consensus        10 lfFEwFLF~~AIFiAItIlYILLalL~EvPkYIK~~VrYl   49 (117)
T PF07234_consen   10 LFFEWFLFFGAIFIAITILYILLALLFEVPKYIKELVRYL   49 (117)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHH
Confidence            4678889999999999999999999999999887665543


No 11 
>PF10642 Tom5:  Mitochondrial import receptor subunit or translocase;  InterPro: IPR019603  This entry represents a short family of yeast proteins. Tom5 is one of three very small translocases of the mitochondrial outer membrane. Tom5 links mitochondrial preprotein receptors to the general import pore []. Although Tom5 has allegedly been identified in vertebrates this could not be confirmed. 
Probab=53.24  E-value=8.4  Score=27.83  Aligned_cols=17  Identities=41%  Similarity=0.714  Sum_probs=12.8

Q ss_pred             HHHHHHHHHhhhhhhhc
Q psy16324         57 ACLSAFAFLFLIPFIIE   73 (251)
Q Consensus        57 avlSlfafLFLvPfvvd   73 (251)
                      ......++|+|.||++|
T Consensus        27 ~a~~~a~~LylsP~~~~   43 (49)
T PF10642_consen   27 NAAAAAALLYLSPFAID   43 (49)
T ss_pred             HHHHHHHHHHHhHHHHH
Confidence            44556678899999886


No 12 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=51.85  E-value=14  Score=39.55  Aligned_cols=33  Identities=24%  Similarity=0.275  Sum_probs=27.4

Q ss_pred             HHHHHhhhhHHHHHHHHHhhhhhccCC-cCCCCC
Q psy16324        216 YLILALVVPIVLFFGSLTILGYWYCPR-KSKVQP  248 (251)
Q Consensus       216 ~Li~a~~VP~vlFvvS~i~L~~~~C~~-~~k~~~  248 (251)
                      .|+.+++==+++.++.++.|+++||.+ |.|.|.
T Consensus       273 ~fLl~ILG~~~livl~lL~vLl~yCrrkc~~~r~  306 (807)
T PF10577_consen  273 VFLLAILGGTALIVLILLCVLLCYCRRKCLKPRQ  306 (807)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhcccCCccc
Confidence            477777777888889999999999995 999874


No 13 
>PF10587 EF-1_beta_acid:  Eukaryotic elongation factor 1 beta central acidic region;  InterPro: IPR018940 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF1B (also known as EF-Ts or EF-1beta/gamma/delta) is a nucleotide exchange factor that is required to regenerate EF1A from its inactive form (EF1A-GDP) to its active form (EF1A-GTP). EF1A is then ready to interact with a new aminoacyl-tRNA to begin the cycle again. EF1B is more complex in eukaryotes than in bacteria, and can consist of three subunits: EF1B-alpha (or EF-1beta), EF1B-gamma (or EF-1gamma) and EF1B-beta (or EF-1delta) []. This region is found in the centre of the beta subunits of Elongation factor-1. More information about these proteins can be found at Protein of the Month: Elongation Factors [].
Probab=49.89  E-value=2.6  Score=27.53  Aligned_cols=18  Identities=56%  Similarity=0.815  Sum_probs=11.4

Q ss_pred             CCcccccccCCccccccc
Q psy16324         16 DSEEDDEEGEGEKEEKLE   33 (251)
Q Consensus        16 ~~~~~~~~~~~~~e~~l~   33 (251)
                      |+||+|+|-+..+||+|.
T Consensus         5 ddEeed~ea~r~reeRla   22 (28)
T PF10587_consen    5 DDEEEDEEAERIREERLA   22 (28)
T ss_pred             ccccccHHHHHHHHHHHH
Confidence            455667777666666653


No 14 
>PF14812 PBP1_TM:  Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A.
Probab=46.32  E-value=4.3  Score=32.08  Aligned_cols=8  Identities=38%  Similarity=0.617  Sum_probs=3.2

Q ss_pred             HHHHHhhh
Q psy16324         61 AFAFLFLI   68 (251)
Q Consensus        61 lfafLFLv   68 (251)
                      +++-||||
T Consensus        70 Llikl~lV   77 (81)
T PF14812_consen   70 LLIKLFLV   77 (81)
T ss_dssp             -TTTTHCC
T ss_pred             HHHHHHHH
Confidence            33445554


No 15 
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=45.16  E-value=65  Score=26.57  Aligned_cols=7  Identities=57%  Similarity=0.895  Sum_probs=3.3

Q ss_pred             hccCCCC
Q psy16324          8 LQNSDKD   14 (251)
Q Consensus         8 ~~~~~~~   14 (251)
                      |++.|.|
T Consensus         4 l~~~d~d   10 (115)
T PF05915_consen    4 LSNEDED   10 (115)
T ss_pred             CCCCCcc
Confidence            4454444


No 16 
>PF10329 DUF2417:  Region of unknown function (DUF2417);  InterPro: IPR019431  This entry represents a family of fungal proteins with no known function. In some cases these proteins also contain an alpha/beta hydrolase fold (IPR000073 from INTERPRO). 
Probab=44.72  E-value=29  Score=31.98  Aligned_cols=43  Identities=28%  Similarity=0.320  Sum_probs=26.9

Q ss_pred             cccCCccccccccCch-hhHHHHHhhhhHHHHHHHHHHHHHHHHHh
Q psy16324         22 EEGEGEKEEKLEVEPE-EQTTLQKAKFYVSLCSGVTACLSAFAFLF   66 (251)
Q Consensus        22 ~~~~~~~e~~l~~~p~-~~t~~ek~~FYttl~l~~tavlSlfafLF   66 (251)
                      +.|..|.||++-+++| ++|++|-  ++.++-.++..++.+++.++
T Consensus       155 ~~gk~eeeerltgr~etr~Tl~Ew--~~i~~~~i~~~~l~v~~~l~  198 (232)
T PF10329_consen  155 EWGKAEEEERLTGRAETRRTLREW--FAILLRTIIKLVLLVVVILI  198 (232)
T ss_pred             HhccchhhcccCCcccccccHHHH--HHHHHHHHHHHHHHHHHHHH
Confidence            5677888899988887 6777764  34444344444445555444


No 17 
>PF02038 ATP1G1_PLM_MAT8:  ATP1G1/PLM/MAT8 family;  InterPro: IPR000272  The FXYD protein family contains at least seven members in mammals []. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.   Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2JO1_A 2JP3_A 2ZXE_G 3A3Y_G 3N23_E 3B8E_H 3KDP_G 3N2F_E.
Probab=43.58  E-value=15  Score=26.86  Aligned_cols=37  Identities=24%  Similarity=0.256  Sum_probs=26.7

Q ss_pred             ecchhhhHHHHHHHhhhhHHHHHHHHHhhhhhccCCcCCC
Q psy16324        207 KYNWDDNLRYLILALVVPIVLFFGSLTILGYWYCPRKSKV  246 (251)
Q Consensus       207 r~d~d~t~~~Li~a~~VP~vlFvvS~i~L~~~~C~~~~k~  246 (251)
                      .|||+.-   =+-.+++-.|+|+++.+++.--.|.|+.+.
T Consensus         8 ~YDy~tL---rigGLi~A~vlfi~Gi~iils~kckCk~~q   44 (50)
T PF02038_consen    8 YYDYETL---RIGGLIFAGVLFILGILIILSGKCKCKFNQ   44 (50)
T ss_dssp             GGCHHHH---HHHHHHHHHHHHHHHHHHHCTTHHHHHHST
T ss_pred             ccchhHh---hccchHHHHHHHHHHHHHHHcCccccCCCC
Confidence            3775543   255677778999999999998888764433


No 18 
>KOG2140|consensus
Probab=42.90  E-value=7.1  Score=40.70  Aligned_cols=20  Identities=45%  Similarity=0.745  Sum_probs=15.3

Q ss_pred             ccCCCCCCCcccccccCCcc
Q psy16324          9 QNSDKDEDSEEDDEEGEGEK   28 (251)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~   28 (251)
                      .|+|.+++|+|||+|+|++.
T Consensus       414 en~d~~~~s~E~~~eee~e~  433 (739)
T KOG2140|consen  414 ENEDDEDGSSEDDDEEEDES  433 (739)
T ss_pred             cccccccccccccccccccc
Confidence            57777888888888877765


No 19 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=42.43  E-value=20  Score=28.50  Aligned_cols=29  Identities=10%  Similarity=0.123  Sum_probs=22.0

Q ss_pred             HHHhhhhHHHHHHHHHHHHHHHHHhhhhh
Q psy16324         42 LQKAKFYVSLCSGVTACLSAFAFLFLIPF   70 (251)
Q Consensus        42 ~ek~~FYttl~l~~tavlSlfafLFLvPf   70 (251)
                      ..+...+..+++++++++.+++++++|-.
T Consensus        55 ~~~~~~~~iili~lls~v~IlVily~IyY   83 (101)
T PF06024_consen   55 ASKQNNGNIILISLLSFVCILVILYAIYY   83 (101)
T ss_pred             ccccccccchHHHHHHHHHHHHHHhhheE
Confidence            34556777888899999999998887543


No 20 
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=39.12  E-value=21  Score=37.21  Aligned_cols=12  Identities=8%  Similarity=0.387  Sum_probs=6.6

Q ss_pred             hchhHHHHhhcC
Q psy16324         72 IEPAIKTIMADY   83 (251)
Q Consensus        72 vdPAisti~~~f   83 (251)
                      +|.++..||..-
T Consensus       737 lD~~La~~Fk~r  748 (784)
T PF04931_consen  737 LDEQLAAIFKER  748 (784)
T ss_pred             HHHHHHHHHHHH
Confidence            366666655543


No 21 
>PF05510 Sarcoglycan_2:  Sarcoglycan alpha/epsilon;  InterPro: IPR008908 Sarcoglycans are a subcomplex of transmembrane proteins which are part of the dystrophin-glycoprotein complex. They are expressed in the skeletal, cardiac and smooth muscle. Although numerous studies have been conducted on the sarcoglycan subcomplex in skeletal and cardiac muscle, the manner of the distribution and localisation of these proteins along the nonjunctional sarcolemma is not clear []. This family contains alpha and epsilon members.; GO: 0016012 sarcoglycan complex
Probab=37.41  E-value=33  Score=33.87  Aligned_cols=27  Identities=22%  Similarity=0.547  Sum_probs=23.7

Q ss_pred             HHHHHHhhhhHHHHHHHHHhhhhhccC
Q psy16324        215 RYLILALVVPIVLFFGSLTILGYWYCP  241 (251)
Q Consensus       215 ~~Li~a~~VP~vlFvvS~i~L~~~~C~  241 (251)
                      .++++.++||.+++++-+++|.+.-|=
T Consensus       283 ~d~~vtl~iPl~i~llL~llLs~Imc~  309 (386)
T PF05510_consen  283 PDFLVTLAIPLIIALLLLLLLSYIMCC  309 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhee
Confidence            357899999999999999999988875


No 22 
>KOG1307|consensus
Probab=36.82  E-value=14  Score=38.01  Aligned_cols=27  Identities=22%  Similarity=0.312  Sum_probs=15.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHhhhhhhhchh
Q psy16324         47 FYVSLCSGVTACLSAFAFLFLIPFIIEPA   75 (251)
Q Consensus        47 FYttl~l~~tavlSlfafLFLvPfvvdPA   75 (251)
                      ||---|++  +|+=..+|-||..-|..=.
T Consensus       424 fF~vTFig--SIlWIA~fSYLMVWwa~~i  450 (588)
T KOG1307|consen  424 FFPVTFIG--SILWIAAFSYLMVWWANII  450 (588)
T ss_pred             eeehHHHH--HHHHHHHHHHHHHHHHHHc
Confidence            33333444  5666667777777775433


No 23 
>TIGR01195 oadG_fam sodium pump decarboxylases, gamma subunit. Most sequences scoring between the noise and trusted cutoffs are eukaryotic sodium channel proteins.
Probab=36.31  E-value=83  Score=24.37  Aligned_cols=41  Identities=17%  Similarity=0.224  Sum_probs=30.7

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhhhhhhhchhHHHHhhcC-CCcc
Q psy16324         46 KFYVSLCSGVTACLSAFAFLFLIPFIIEPAIKTIMADY-EAEP   87 (251)
Q Consensus        46 ~FYttl~l~~tavlSlfafLFLvPfvvdPAisti~~~f-~~~P   87 (251)
                      +|..++-+.++|+.-+|+||-+.-+++.. ++.+...| .|+|
T Consensus         3 ll~~~~~l~v~GM~~VF~fL~lLi~~i~~-~~~~~~~~~~~e~   44 (82)
T TIGR01195         3 LLLEGATLTVLGMGIVFLFLSLLIYAVRG-MGKVVGRKKVPEP   44 (82)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHhccCCCCc
Confidence            56677888888999889888887777775 56677777 4444


No 24 
>PF00283 Cytochrom_B559:  Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits;  InterPro: IPR013081 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  Cytochrome b559, which forms part of the reaction centre core of PSII is a heterodimer composed of one alpha subunit (PsbE), one beta (PsbF) subunit, and a haem cofactor. Two histidine residues from each subunit coordinate the haem. Although cytochrome b559 is a redox-active protein, it is unlikely to be involved in the primary electron transport in PSII due to its very slow photo-oxidation and photo-reduction kinetics. Instead, cytochrome b559 could participate in a secondary electron transport pathway that helps protect PSII from photo-damage. Cytochrome b559 is essential for PSII assembly []. This domain occurs in both the alpha and beta subunits of cytochrome B559. In the alpha sbunit it occurs together with a lumenal domain (IPR013082 from INTERPRO), while in the beta subunit it occurs on its own.; GO: 0046872 metal ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0009536 plastid, 0009579 thylakoid, 0016021 integral to membrane; PDB: 3ARC_f 3A0H_f 3A0B_f 1W5C_K 1S5L_e 3BZ2_E 3PRQ_E 1IZL_P 2AXT_E 4FBY_R ....
Probab=35.96  E-value=29  Score=22.87  Aligned_cols=14  Identities=43%  Similarity=0.854  Sum_probs=11.9

Q ss_pred             HHHHHhhhhHHHHH
Q psy16324        216 YLILALVVPIVLFF  229 (251)
Q Consensus       216 ~Li~a~~VP~vlFv  229 (251)
                      -.||+++||.+.|+
T Consensus        15 ~~IH~l~iPtvf~~   28 (29)
T PF00283_consen   15 WAIHALTIPTVFFL   28 (29)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             eeeeecccceEEec
Confidence            46899999999885


No 25 
>COG3736 VirB8 Type IV secretory pathway, component VirB8 [Intracellular trafficking and secretion]
Probab=35.81  E-value=25  Score=32.63  Aligned_cols=27  Identities=19%  Similarity=0.351  Sum_probs=23.1

Q ss_pred             HhhhhHHHHHHHHHHHHHHHHHhhhhh
Q psy16324         44 KAKFYVSLCSGVTACLSAFAFLFLIPF   70 (251)
Q Consensus        44 k~~FYttl~l~~tavlSlfafLFLvPf   70 (251)
                      |..|.+..++.++++++++++.+|+|+
T Consensus        41 ~~~~~va~~~~~l~v~~~~~Ia~llPL   67 (239)
T COG3736          41 RLAWRVAILFTLLAVAAVIAIAILLPL   67 (239)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhccc
Confidence            677777777799999999999999886


No 26 
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=33.73  E-value=21  Score=39.44  Aligned_cols=21  Identities=29%  Similarity=0.603  Sum_probs=12.5

Q ss_pred             hhhHHHHHHHHHHHHHHHHHh
Q psy16324         46 KFYVSLCSGVTACLSAFAFLF   66 (251)
Q Consensus        46 ~FYttl~l~~tavlSlfafLF   66 (251)
                      +||.-.|++-+..+++++++-
T Consensus       932 k~y~ltFi~SIiwIsi~Syil  952 (1096)
T TIGR00927       932 KFFVITFLGSIMWIAMFSYLM  952 (1096)
T ss_pred             ceeeehHHHHHHHHHHHHHHH
Confidence            356555666556666666653


No 27 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=33.17  E-value=1.7e+02  Score=23.62  Aligned_cols=49  Identities=12%  Similarity=0.089  Sum_probs=36.5

Q ss_pred             CcceeeeeCC-CCCceeEEecchhhhHHHHHHHhhhhHHHHHHHHHhhhh
Q psy16324        189 KPFPCYYSKV-FPTLHVVAKYNWDDNLRYLILALVVPIVLFFGSLTILGY  237 (251)
Q Consensus       189 a~FPCYYSr~-~p~~~Vvar~d~d~t~~~Li~a~~VP~vlFvvS~i~L~~  237 (251)
                      ..+...-... .+.+.|....+-...++.-++..++|+++|+++.++.-+
T Consensus        42 ~~~~~~~~~~~~~GD~V~v~i~~~~~~~aa~l~Y~lPll~li~g~~l~~~   91 (135)
T PF04246_consen   42 ITFRAPNPIGAKVGDRVEVEIPESSLLKAAFLVYLLPLLALIAGAVLGSY   91 (135)
T ss_pred             EEEEecCCCCCCCCCEEEEEeccchHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4555544433 566668888888888888899999999999998876543


No 28 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=32.04  E-value=22  Score=41.86  Aligned_cols=11  Identities=18%  Similarity=0.419  Sum_probs=8.0

Q ss_pred             CcceeeeeCCC
Q psy16324        189 KPFPCYYSKVF  199 (251)
Q Consensus       189 a~FPCYYSr~~  199 (251)
                      -.||||+.-+-
T Consensus       453 ~~~pc~fqlna  463 (2849)
T PTZ00415        453 IKHPCVFKLNA  463 (2849)
T ss_pred             CCCceEEEecc
Confidence            35999987653


No 29 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=30.99  E-value=24  Score=41.54  Aligned_cols=15  Identities=33%  Similarity=0.233  Sum_probs=7.1

Q ss_pred             ccccCchhhHHHHHh
Q psy16324         31 KLEVEPEEQTTLQKA   45 (251)
Q Consensus        31 ~l~~~p~~~t~~ek~   45 (251)
                      +++.|+-+.-.-||.
T Consensus       187 ~~~~~~ge~~~~~~~  201 (2849)
T PTZ00415        187 DEEDEGGEDFTYEKS  201 (2849)
T ss_pred             hccCCCCcccccccc
Confidence            455555544334443


No 30 
>PRK02919 oxaloacetate decarboxylase subunit gamma; Provisional
Probab=30.94  E-value=1.1e+02  Score=24.03  Aligned_cols=43  Identities=23%  Similarity=0.342  Sum_probs=28.1

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhhhhhhhchhHHHHhhcCCCccee
Q psy16324         46 KFYVSLCSGVTACLSAFAFLFLIPFIIEPAIKTIMADYEAEPVT   89 (251)
Q Consensus        46 ~FYttl~l~~tavlSlfafLFLvPfvvdPAisti~~~f~~~Pv~   89 (251)
                      ++.-++-|-++|..-+|+||.+.-+.+. -++.+...|.|+|+.
T Consensus         6 ll~~gl~lMvlGMg~VfvFL~lLI~~i~-~ms~l~~~~~pe~~~   48 (82)
T PRK02919          6 LLGEGFTLMFLGMGFVLAFLFLLIFAIR-GMSALINRFFPEPVA   48 (82)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHhhCCCccC
Confidence            4456666667777777777766554443 567777778787643


No 31 
>PF08627 CRT-like:  CRT-like;  InterPro: IPR013936  This region is found in proteins related to Plasmodium falciparum chloroquine resistance transporter (CRT). 
Probab=30.81  E-value=1.2e+02  Score=26.22  Aligned_cols=20  Identities=15%  Similarity=0.209  Sum_probs=12.1

Q ss_pred             ccccCchhhHHHHHhhhhHH
Q psy16324         31 KLEVEPEEQTTLQKAKFYVS   50 (251)
Q Consensus        31 ~l~~~p~~~t~~ek~~FYtt   50 (251)
                      +...+.+++.+.||.+=|..
T Consensus        29 ~~~~~i~~~~~~~k~k~~~k   48 (130)
T PF08627_consen   29 QNESNIKQKSISEKIKDFLK   48 (130)
T ss_pred             cccccchHHHHHHHHHHHHH
Confidence            33445556667777766654


No 32 
>PRK13872 conjugal transfer protein TrbF; Provisional
Probab=29.80  E-value=69  Score=28.43  Aligned_cols=27  Identities=4%  Similarity=-0.160  Sum_probs=17.9

Q ss_pred             HhhhhHHHHHHHHHHHHHHHHHhhhhh
Q psy16324         44 KAKFYVSLCSGVTACLSAFAFLFLIPF   70 (251)
Q Consensus        44 k~~FYttl~l~~tavlSlfafLFLvPf   70 (251)
                      |++...++..+++++++++++.++.|+
T Consensus        39 ~~w~~va~~~l~i~~~~v~av~~l~pl   65 (228)
T PRK13872         39 RNWRLMAFGCLALSAGLAGGLVWQSAR   65 (228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhcc
Confidence            345545555566677788888888763


No 33 
>PF11368 DUF3169:  Protein of unknown function (DUF3169);  InterPro: IPR021509  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function. 
Probab=29.50  E-value=56  Score=29.21  Aligned_cols=23  Identities=9%  Similarity=0.274  Sum_probs=13.7

Q ss_pred             HhhhhHHHHHHHHHHHHHHHHHh
Q psy16324         44 KAKFYVSLCSGVTACLSAFAFLF   66 (251)
Q Consensus        44 k~~FYttl~l~~tavlSlfafLF   66 (251)
                      |..-|.+++..+..+++++++++
T Consensus        97 r~~~~~~i~~~i~~i~~~~~l~~  119 (248)
T PF11368_consen   97 RKLEYATIFFNISIIISFLSLFI  119 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            34455666666666666666555


No 34 
>TIGR00964 secE_bact preprotein translocase, SecE subunit, bacterial. This model represents exclusively the bacterial (and some organellar) SecE protein. SecE is part of the core heterotrimer, SecYEG, of the Sec preprotein translocase system. Other components are the ATPase SecA, a cytosolic chaperone SecB, and an accessory complex of SecDF and YajC.
Probab=28.86  E-value=91  Score=22.10  Aligned_cols=34  Identities=24%  Similarity=0.171  Sum_probs=20.0

Q ss_pred             ccccccCchhhHHHHHhhhhHHHHHHHHHHHHHHHHHh
Q psy16324         29 EEKLEVEPEEQTTLQKAKFYVSLCSGVTACLSAFAFLF   66 (251)
Q Consensus        29 e~~l~~~p~~~t~~ek~~FYttl~l~~tavlSlfafLF   66 (251)
                      |-+...=|.+    +....++.+-+++++++|++.+++
T Consensus        11 ElkkV~WPt~----~e~~~~t~~Vi~~~~~~~~~~~~~   44 (55)
T TIGR00964        11 ELKKVVWPSR----KELITYTIVVIVFVIFFSLFLFGV   44 (55)
T ss_pred             HHhcCcCcCH----HHHHhHHHHHHHHHHHHHHHHHHH
Confidence            3444444543    344456777777777777766543


No 35 
>COG4038 Predicted membrane protein [Function unknown]
Probab=28.54  E-value=34  Score=27.32  Aligned_cols=32  Identities=22%  Similarity=0.282  Sum_probs=23.4

Q ss_pred             HhhhhHHHHHHHHHHHHHHHHHhhhhhhhchhHHHH
Q psy16324         44 KAKFYVSLCSGVTACLSAFAFLFLIPFIIEPAIKTI   79 (251)
Q Consensus        44 k~~FYttl~l~~tavlSlfafLFLvPfvvdPAisti   79 (251)
                      .++||+++++++.|.++-.+    -|.+-||-.+.+
T Consensus         5 ~~~~y~ga~~ii~gs~~~~~----gp~~~dpiv~~L   36 (87)
T COG4038           5 EAILYTGAFMIILGTLGAAI----GPARSDPVVKSL   36 (87)
T ss_pred             hhhhhhccHHHHHhHHHhhc----CCcccCcHHHHh
Confidence            47999999999998887543    356666665543


No 36 
>KOG1832|consensus
Probab=28.53  E-value=25  Score=39.02  Aligned_cols=20  Identities=40%  Similarity=0.817  Sum_probs=8.2

Q ss_pred             CCCCCCCcccccccCCcccc
Q psy16324         11 SDKDEDSEEDDEEGEGEKEE   30 (251)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~e~   30 (251)
                      +|.+||+|++|++++++.|+
T Consensus      1407 ~DeeeD~e~Ed~dEddd~ed 1426 (1516)
T KOG1832|consen 1407 SDEEEDDETEDEDEDDDEED 1426 (1516)
T ss_pred             cCccccchhhcccccccccc
Confidence            34444444444333333333


No 37 
>PF03248 Rer1:  Rer1 family;  InterPro: IPR004932  RER1 family proteins are involved in involved in the retrieval of some endoplasmic reticulum membrane proteins from the early golgi compartment. The C terminus of yeast Rer1p interacts with a coatomer complex [].; GO: 0016021 integral to membrane
Probab=28.21  E-value=81  Score=28.15  Aligned_cols=31  Identities=13%  Similarity=0.118  Sum_probs=13.8

Q ss_pred             ccCchhhHHHH-HhhhhHHHHHHHHHHHHHHH
Q psy16324         33 EVEPEEQTTLQ-KAKFYVSLCSGVTACLSAFA   63 (251)
Q Consensus        33 ~~~p~~~t~~e-k~~FYttl~l~~tavlSlfa   63 (251)
                      +-+|=.|++-| |.+.+.+-...+..+.++|.
T Consensus        97 EFrPFiRRlPEFkFW~~~tka~~i~~~~tff~  128 (176)
T PF03248_consen   97 EFRPFIRRLPEFKFWYSCTKATVISLFCTFFP  128 (176)
T ss_pred             ccCCccccchhhHHHHHHHHHHHHHHHHHHHH
Confidence            44555556555 33333333333333444443


No 38 
>COG3630 OadG Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, gamma subunit [Energy production and conversion]
Probab=27.32  E-value=1.3e+02  Score=24.08  Aligned_cols=40  Identities=15%  Similarity=0.207  Sum_probs=26.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhhhchhHHHHhhcCCCccee
Q psy16324         49 VSLCSGVTACLSAFAFLFLIPFIIEPAIKTIMADYEAEPVT   89 (251)
Q Consensus        49 ttl~l~~tavlSlfafLFLvPfvvdPAisti~~~f~~~Pv~   89 (251)
                      -++-|-++|+-=+|+|||+.-+ +.=.++.+..+|.|+|+-
T Consensus         9 eg~~L~vlGmg~VflfL~iLi~-~~~~m~~~v~r~~pee~~   48 (84)
T COG3630           9 EGITLMVLGMGFVFLFLSILIY-AMRGMGAVVRRFVPEEVP   48 (84)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHhhCCCCCC
Confidence            4455566666666777766544 345778888888887653


No 39 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=27.29  E-value=1.3e+02  Score=20.60  Aligned_cols=38  Identities=18%  Similarity=0.313  Sum_probs=16.3

Q ss_pred             HHHHHhhhhHHHHH-HHHHHHHHHHHHhhhhhhhchhHHHHh
Q psy16324         40 TTLQKAKFYVSLCS-GVTACLSAFAFLFLIPFIIEPAIKTIM   80 (251)
Q Consensus        40 t~~ek~~FYttl~l-~~tavlSlfafLFLvPfvvdPAisti~   80 (251)
                      .++++-....++.+ ++.-++++++ -++.|.  ||.-+.+-
T Consensus        11 ~f~~nk~a~~gl~il~~~vl~ai~~-p~~~p~--~~~~~d~~   49 (56)
T PF12911_consen   11 RFRRNKLAVIGLIILLILVLLAIFA-PFISPY--DPNQQDLS   49 (56)
T ss_pred             HHHhCchHHHHHHHHHHHHHHHHHH-HHcCCC--CcchhhHH
Confidence            44444444444444 3333333333 234554  55555543


No 40 
>PRK13865 type IV secretion system protein VirB8; Provisional
Probab=27.17  E-value=72  Score=29.03  Aligned_cols=25  Identities=20%  Similarity=0.173  Sum_probs=18.8

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhhhhh
Q psy16324         46 KFYVSLCSGVTACLSAFAFLFLIPF   70 (251)
Q Consensus        46 ~FYttl~l~~tavlSlfafLFLvPf   70 (251)
                      .+-.+...++.+++|++|+..|.|+
T Consensus        40 aw~va~~~~~~~~~~~~Av~~l~PL   64 (229)
T PRK13865         40 LAAVAGIAVAGNVAQAFAIATMVPL   64 (229)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccc
Confidence            3445556677888899999998886


No 41 
>KOG2262|consensus
Probab=26.79  E-value=63  Score=34.60  Aligned_cols=34  Identities=12%  Similarity=0.192  Sum_probs=19.4

Q ss_pred             CCcccccEEeeccCCCCCCCC-CchhHHHHHhCCC
Q psy16324        145 PWDHEDIRFLINTEGCGYPPG-TNCTNFVKQYGLP  178 (251)
Q Consensus       145 ~w~~~esrLliN~kGCgypP~-~nCk~F~~~YG~d  178 (251)
                      .|.---.|++|++--==-|-. +.|+-|-.-|+++
T Consensus       196 GwAGl~Rk~lV~Pa~m~WPsnLvqvsLFraLHeke  230 (761)
T KOG2262|consen  196 GWAGLFRKYLVYPASMWWPSNLVQVSLFRALHEKE  230 (761)
T ss_pred             cHhhhhHhhccCcHhhcCcchhHHHHHHHHHHhhh
Confidence            344444566665442222111 4788899999987


No 42 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=26.45  E-value=64  Score=24.97  Aligned_cols=17  Identities=24%  Similarity=0.526  Sum_probs=12.6

Q ss_pred             HHhhhhHHHHHHHHHhh
Q psy16324        219 LALVVPIVLFFGSLTIL  235 (251)
Q Consensus       219 ~a~~VP~vlFvvS~i~L  235 (251)
                      .++++|+++|++.+..+
T Consensus         4 ~fl~~Pliif~ifVap~   20 (75)
T TIGR02976         4 FFLAIPLIIFVIFVAPL   20 (75)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46789999998765543


No 43 
>PRK13887 conjugal transfer protein TrbF; Provisional
Probab=25.85  E-value=86  Score=28.37  Aligned_cols=25  Identities=12%  Similarity=-0.104  Sum_probs=16.5

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhhhhh
Q psy16324         46 KFYVSLCSGVTACLSAFAFLFLIPF   70 (251)
Q Consensus        46 ~FYttl~l~~tavlSlfafLFLvPf   70 (251)
                      +...++..++++++|++++.+|.|+
T Consensus        55 w~v~a~~~~~ia~~~v~av~~l~pl   79 (250)
T PRK13887         55 WQVVGILSLLIALAAVGGVIHIGSQ   79 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcc
Confidence            3333444466678888888888665


No 44 
>PF14816 FAM178:  Family of unknown function, FAM178
Probab=25.46  E-value=40  Score=33.25  Aligned_cols=24  Identities=21%  Similarity=0.317  Sum_probs=13.7

Q ss_pred             ccccccCcccceEEEEEeeccchh
Q psy16324        110 REGCTAQMIKCHQISVHYSRMFFK  133 (251)
Q Consensus       110 REGCTs~~y~C~QI~Vnys~~~~~  133 (251)
                      |.|+.+.+|...+--|-..++-|+
T Consensus       135 ~~G~Ls~~Y~~~~CP~pll~WLFq  158 (377)
T PF14816_consen  135 RSGLLSQLYLHQPCPVPLLQWLFQ  158 (377)
T ss_pred             HHHHHHHhhcCCCCChHHHHHHHH
Confidence            568888887655433444444444


No 45 
>KOG0772|consensus
Probab=24.58  E-value=37  Score=35.38  Aligned_cols=8  Identities=63%  Similarity=0.696  Sum_probs=4.8

Q ss_pred             hhhccCCC
Q psy16324          6 TKLQNSDK   13 (251)
Q Consensus         6 ~~~~~~~~   13 (251)
                      +-+|.||+
T Consensus       123 ~a~~es~~  130 (641)
T KOG0772|consen  123 TALQESDS  130 (641)
T ss_pred             cccccccC
Confidence            34566666


No 46 
>PF11947 DUF3464:  Protein of unknown function (DUF3464);  InterPro: IPR021855  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 137 to 196 amino acids in length. 
Probab=23.97  E-value=1.5e+02  Score=25.88  Aligned_cols=38  Identities=11%  Similarity=0.248  Sum_probs=24.9

Q ss_pred             cccccCch-hhHHHHHhhhhHHHHHHHHHHHHHHHHHhhh
Q psy16324         30 EKLEVEPE-EQTTLQKAKFYVSLCSGVTACLSAFAFLFLI   68 (251)
Q Consensus        30 ~~l~~~p~-~~t~~ek~~FYttl~l~~tavlSlfafLFLv   68 (251)
                      ++..+|.. -++++.|..+.+++=++ +|+.++++|.+|+
T Consensus        49 ~~~~IP~~Vs~RM~rRm~~~~GiP~~-lG~~~f~~~y~l~   87 (153)
T PF11947_consen   49 DDSAIPEVVSNRMLRRMAVFVGIPTA-LGVAVFVVFYYLK   87 (153)
T ss_pred             cccccCHHHHHHHHHHHHHHhchHHH-HHHHHHHHHHHHH
Confidence            33344433 57788888888877664 4777777777763


No 47 
>PF11712 Vma12:  Endoplasmic reticulum-based factor for assembly of V-ATPase;  InterPro: IPR021013 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [].  The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum []. 
Probab=23.85  E-value=1.7e+02  Score=24.24  Aligned_cols=31  Identities=6%  Similarity=-0.088  Sum_probs=20.8

Q ss_pred             HHHHH-HHHHHHHHHHHHhhhhh----hhchhHHHH
Q psy16324         49 VSLCS-GVTACLSAFAFLFLIPF----IIEPAIKTI   79 (251)
Q Consensus        49 ttl~l-~~tavlSlfafLFLvPf----vvdPAisti   79 (251)
                      .++.+ ++++++++|+++|-.+-    +.+.+.+-+
T Consensus        79 ls~v~Nilvsv~~~~~~~~~~~~~~~~~~~~~~Rvl  114 (142)
T PF11712_consen   79 LSTVFNILVSVFAVFFAGWYWAGYSFGGWSFPYRVL  114 (142)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhcccchHHHHH
Confidence            45555 88899999999995444    445554443


No 48 
>PF14143 YrhC:  YrhC-like protein
Probab=23.29  E-value=1.7e+02  Score=22.71  Aligned_cols=42  Identities=24%  Similarity=0.099  Sum_probs=33.1

Q ss_pred             HHHHHhhhhHHHHHHHHHHHHHHHHHhhhh-hhhchhHHHHhh
Q psy16324         40 TTLQKAKFYVSLCSGVTACLSAFAFLFLIP-FIIEPAIKTIMA   81 (251)
Q Consensus        40 t~~ek~~FYttl~l~~tavlSlfafLFLvP-fvvdPAisti~~   81 (251)
                      .+++|+-=|.-..++++|+.+.+-++.++| .-.+++-+.+++
T Consensus         2 ~l~~Ki~DyKrf~~vLLAvs~FlYiG~viP~~~~~~~~~~~m~   44 (72)
T PF14143_consen    2 ELKEKIEDYKRFAFVLLAVSTFLYIGTVIPIGAKETAQKYIMM   44 (72)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHhhCCccchhHHHHHHHH
Confidence            467788888888889999988888888888 666666666554


No 49 
>PRK02561 psbF cytochrome b559 subunit beta; Provisional
Probab=23.28  E-value=20  Score=25.63  Aligned_cols=19  Identities=37%  Similarity=0.670  Sum_probs=15.6

Q ss_pred             HHHHHhhhhHHHHHHHHHh
Q psy16324        216 YLILALVVPIVLFFGSLTI  234 (251)
Q Consensus       216 ~Li~a~~VP~vlFvvS~i~  234 (251)
                      --+|+++||.|.|+-|...
T Consensus        20 lAvhalavPtVfFlGaI~A   38 (44)
T PRK02561         20 LAVHALGVPTVFFLGAIAA   38 (44)
T ss_pred             hhhhccccCceeeccHHHH
Confidence            3589999999999877654


No 50 
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT).
Probab=22.87  E-value=1.3e+02  Score=29.35  Aligned_cols=15  Identities=7%  Similarity=0.020  Sum_probs=7.7

Q ss_pred             CchhhHHHHHhhhhH
Q psy16324         35 EPEEQTTLQKAKFYV   49 (251)
Q Consensus        35 ~p~~~t~~ek~~FYt   49 (251)
                      +++...+..|.+.+.
T Consensus       261 ~~~~~~v~kki~~~~  275 (437)
T TIGR00939       261 KTSVWVVFTKVWLLA  275 (437)
T ss_pred             cCcHHHHHHHHHHHH
Confidence            334445556666554


No 51 
>PF02532 PsbI:  Photosystem II reaction centre I protein (PSII 4.8 kDa protein);  InterPro: IPR003686 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbI, which is tightly associated with the D1/D2 heterodimer in PSII. The function of PsbI is unknown, but it may be involved in the assembly, dimerisation or stabilisation of PSII dimers [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_i 3ARC_I 3A0B_i 3BZ2_I 3PRQ_I 3KZI_I 3PRR_I 2AXT_i 4FBY_I 1S5L_i ....
Probab=22.81  E-value=1.2e+02  Score=20.94  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=11.7

Q ss_pred             HHHHHHHHHhhhhhhhchh
Q psy16324         57 ACLSAFAFLFLIPFIIEPA   75 (251)
Q Consensus        57 avlSlfafLFLvPfvvdPA   75 (251)
                      -..|+|+|+||   -=||+
T Consensus        14 ffv~LFifGfl---snDp~   29 (36)
T PF02532_consen   14 FFVSLFIFGFL---SNDPG   29 (36)
T ss_dssp             HHHHHHHHHHH---TTCTT
T ss_pred             HHHHHHhcccc---CCCCC
Confidence            55789999998   45554


No 52 
>PHA02831 EEV host range protein; Provisional
Probab=22.78  E-value=54  Score=30.71  Aligned_cols=44  Identities=23%  Similarity=0.380  Sum_probs=25.2

Q ss_pred             EecchhhhHHHHHHHhhhhHHHHHHHHHhhhhhccCCcCCCCCCC
Q psy16324        206 AKYNWDDNLRYLILALVVPIVLFFGSLTILGYWYCPRKSKVQPAY  250 (251)
Q Consensus       206 ar~d~d~t~~~Li~a~~VP~vlFvvS~i~L~~~~C~~~~k~~~~~  250 (251)
                      +.|||..++...|+.+.+=..+|+++++.|. --|....-..|.|
T Consensus       222 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  265 (268)
T PHA02831        222 TNYNMQQNIITIIILLSIICFIFVLGLIALF-LSCNKSTLKPSIY  265 (268)
T ss_pred             cccccccceEeehhHHHHHHHHHHHHHHHHh-hcccccccCcccc
Confidence            5677777655556666666666777766543 3454444444443


No 53 
>TIGR02120 GspF general secretion pathway protein F. This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the"Type II" secretion pathway. The GSP transports proteins (generally virulence-associated cell wall hydrolases) across the outer membrase of the bacterial cell. Transport across the inner membrane is often, but not exclusively handled by the Sec system. This model was constructed from the broader subfamily model, pfam00482 which includes components of pilin complexes (PilC) as well as other related genes. GspF is nearly always gene clustered with other GSP subunits. Some genes from Xylella and Xanthomonas strains score below the trusted cutoff due to excessive divergence from the family such that a sequence from Deinococcus which does not appear to be GspF scores higher.
Probab=22.69  E-value=2e+02  Score=27.13  Aligned_cols=23  Identities=17%  Similarity=0.155  Sum_probs=18.0

Q ss_pred             HHHHHhhhhHHHHHHHHHhhhhh
Q psy16324        216 YLILALVVPIVLFFGSLTILGYW  238 (251)
Q Consensus       216 ~Li~a~~VP~vlFvvS~i~L~~~  238 (251)
                      +.+.+++=|+.+.+++.+++.+.
T Consensus       363 ~~~~~lieP~~il~ig~~v~~i~  385 (399)
T TIGR02120       363 ATLTALLEPLLIVVMGGVVLFIV  385 (399)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46677888999998888877654


No 54 
>PRK07597 secE preprotein translocase subunit SecE; Reviewed
Probab=22.68  E-value=1.4e+02  Score=21.66  Aligned_cols=34  Identities=18%  Similarity=0.104  Sum_probs=19.4

Q ss_pred             ccccccCchhhHHHHHhhhhHHHHHHHHHHHHHHHHHh
Q psy16324         29 EEKLEVEPEEQTTLQKAKFYVSLCSGVTACLSAFAFLF   66 (251)
Q Consensus        29 e~~l~~~p~~~t~~ek~~FYttl~l~~tavlSlfafLF   66 (251)
                      |-+...=|.+    +...-++..-++++.++|+|.+++
T Consensus        20 ElkkV~WPs~----~e~~~~t~~Vi~~~~~~~~~i~~v   53 (64)
T PRK07597         20 ELKKVTWPTR----KELVRSTIVVLVFVAFFALFFYLV   53 (64)
T ss_pred             HHhhCcCcCH----HHHHhHHHHHHHHHHHHHHHHHHH
Confidence            3344444443    334456777777777777666543


No 55 
>COG3872 Predicted metal-dependent enzyme [General function prediction only]
Probab=22.53  E-value=74  Score=30.74  Aligned_cols=27  Identities=26%  Similarity=0.256  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhhhchhHH
Q psy16324         49 VSLCSGVTACLSAFAFLFLIPFIIEPAIK   77 (251)
Q Consensus        49 ttl~l~~tavlSlfafLFLvPfvvdPAis   77 (251)
                      +-+.++..|++|+.--.|+  |.+=|.+-
T Consensus       105 ~~l~la~igvlsf~f~~~v--F~lvPvfL  131 (318)
T COG3872         105 MILGLAVIGVLSFVFGKFV--FTLVPVFL  131 (318)
T ss_pred             HHHHHHHHHHHHHHHhhHh--heehHHHH
Confidence            3344455677665432222  34445443


No 56 
>PHA02954 EEV membrane glycoprotein; Provisional
Probab=22.50  E-value=14  Score=35.31  Aligned_cols=27  Identities=26%  Similarity=0.386  Sum_probs=22.8

Q ss_pred             hhhhHHHHHHHhhhhHHHHHHHHHhhh
Q psy16324        210 WDDNLRYLILALVVPIVLFFGSLTILG  236 (251)
Q Consensus       210 ~d~t~~~Li~a~~VP~vlFvvS~i~L~  236 (251)
                      ++.+|..+|+|+.|-.|+|+||+++|.
T Consensus       274 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  300 (317)
T PHA02954        274 LEATYHIIIVALTIMGVIFLISVIVLV  300 (317)
T ss_pred             hhceeeEeeeehhhhHHHHhheeeEEE
Confidence            566777788999999999999998874


No 57 
>PF11271 DUF3068:  Protein of unknown function (DUF3068);  InterPro: IPR021424  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=22.42  E-value=75  Score=29.45  Aligned_cols=36  Identities=14%  Similarity=0.180  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhhchhHHHHhhcCCCc
Q psy16324         50 SLCSGVTACLSAFAFLFLIPFIIEPAIKTIMADYEAE   86 (251)
Q Consensus        50 tl~l~~tavlSlfafLFLvPfvvdPAisti~~~f~~~   86 (251)
                      ++.|+.+|++ ++++..|+|+|+-|.+..+=.|.+..
T Consensus         4 ~~~l~~lG~~-llv~a~llp~~v~~~l~~lPld~~~t   39 (301)
T PF11271_consen    4 SAVLLGLGVF-LLVAAILLPTYVVPRLAKLPLDLDQT   39 (301)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHhcccccccCCCCCCce
Confidence            5566666744 55678899999999988877665544


No 58 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=21.63  E-value=49  Score=33.55  Aligned_cols=17  Identities=18%  Similarity=0.177  Sum_probs=6.8

Q ss_pred             eeeeeecCCCcCCcccc
Q psy16324         92 ISRHDINLGISNCNWAS  108 (251)
Q Consensus        92 tt~~~~~~G~~NCtWsS  108 (251)
                      +.++......++.+-.|
T Consensus       141 ~~r~~~~~~~S~sS~~S  157 (458)
T PF10446_consen  141 VRRRSSHRRSSDSSIES  157 (458)
T ss_pred             ccccccccCCCCCcccc
Confidence            33333333444444433


No 59 
>PRK13553 fumarate reductase cytochrome b-556 subunit; Provisional
Probab=21.53  E-value=1.4e+02  Score=28.14  Aligned_cols=30  Identities=23%  Similarity=0.290  Sum_probs=25.8

Q ss_pred             hhHHHHHhhhhHHHHHHHHHHHHHHHHHhh
Q psy16324         38 EQTTLQKAKFYVSLCSGVTACLSAFAFLFL   67 (251)
Q Consensus        38 ~~t~~ek~~FYttl~l~~tavlSlfafLFL   67 (251)
                      .|...+|++-..+.+|+.+|++|+.||.++
T Consensus       203 ~R~~~~~v~~~i~v~f~~lGl~sL~af~~i  232 (258)
T PRK13553        203 SRKKLKKVKWALSVFFLVLGLLTLAAYIKI  232 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            457778888889999999999999998886


No 60 
>PF02487 CLN3:  CLN3 protein;  InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age. The disease is characterised by progressive loss of vision, seizures and psychomotor disturbances. Biochemically, the disease is characterised by lysosomal accumulation of hydrophobic material, mainly ATP synthase subunit C, largely in the brain but also in other tissues. The disease is fatal within a decade []. Mutations in the CLN3 gene are believed to cause Batten's disease []. The CLN3 gene, with a predicted 438-residue product, maps to chromosome p16p12.1. The gene contains at least 15 exons spanning 15kb and is highly conserved in mammals []. A 1.02kb deletion in the CLN3 gene, occurring in either one or both alleles, is found in 85% of Batten disease chromosomes causing a frameshift generating a predicted translated product of 181 amino acid residues [, ]. 22 other mutations, including deletions, insertions and point mutations, have been reported. It has been suggested that such mutations result in severely truncated CLN3 proteins, or affect its structure/conformation [, ]. CLN3 proteins, which are believed to associate in complexes, are heavily glycosylated lysosomal membrane proteins [], containing complex Asn-linked oligosaccharides []. Extensive glycosylation is important for the stability of these lysosomal proteins in the highly hydrolytic lysosomal lumen. Lysosomal sequestration of active lysosomal enzymes, transport of degraded molecules from the lysosomes, and fusion and fission between lysosomes and other organelles. The CLN3 protein is a 43kDa, highly hydrophobic, multi-transmembrane (TM), phosphorylated protein []. Hydrophobicity analysis predicts 6-9 TM segments, suggesting that CLN3 is a TM protein that may function as a chaperone or signal transducer. The majority of putative phosphorylation sites are found in the N-terminal domain, encompassing 150 residues []. Phosphorylation is believed to be important for membrane compartment interaction, in the formation of functional complexes, and in regulation and interactions with other proteins []. CLN3 contains several motifs that may undergo lipid post-translational modifications (PTMs). PTMs contribute to targeting and anchoring of modified proteins to distinct biological membranes []. There are three general classes of lipid modification: N-terminal myristoylation, C-terminal prenylation, and palmitoylation of cysteine residues. Such modifications are believed to be a common form of PTM occurring in 0.5% of all cellular proteins, including brain tissue []. The C terminus of the CLN3 contains various lipid modification sites: C435, target for prenylation; G419, target for myristoylation; and C414, target for palmitoylation []. Prenylation results in protein hydrophobicity, influences interaction with upstream regulatory proteins and downstream effectors, facilitates protein-protein interaction (multisubunit assembly) and promotes anchoring to membrane lipids. The prenylation motif, Cys-A-A-X, is highly conserved within CLN3 protein sequences of different species []. Species with known CLN3 protein homologues include: Homo sapiens, Canis familiaris, Mus musculus, Saccharomyces cerevisiae and Drosophila melanogaster.; GO: 0016020 membrane
Probab=21.50  E-value=2.1e+02  Score=28.28  Aligned_cols=40  Identities=10%  Similarity=0.059  Sum_probs=25.2

Q ss_pred             CchhhHHHHHhhhhHHHHHHHHHHHHHHHHHhhhhhhhchhHHH
Q psy16324         35 EPEEQTTLQKAKFYVSLCSGVTACLSAFAFLFLIPFIIEPAIKT   78 (251)
Q Consensus        35 ~p~~~t~~ek~~FYttl~l~~tavlSlfafLFLvPfvvdPAist   78 (251)
                      ...+.+++||.+....+..-+.-.+.+..+=+    ++-.++.+
T Consensus       229 ~~~~~~~~~k~~~~k~Ll~ymiPL~lVY~aEY----~InqGv~~  268 (402)
T PF02487_consen  229 SSSKLSFKEKLKRLKPLLWYMIPLFLVYFAEY----FINQGVAP  268 (402)
T ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHhchHH
Confidence            44567899999988887765555554444444    45555544


No 61 
>TIGR01333 cyt_b559_beta cytochrome b559, beta subunit. This model describes the beta subunit of cytochrome b559, about 40 residues in length. It is homologous to the N-terminal half of the alpha subunit, a protein of about 83 residues. Cytochrome b559 is associated with photosystem II.
Probab=21.45  E-value=19  Score=25.57  Aligned_cols=19  Identities=47%  Similarity=0.861  Sum_probs=15.5

Q ss_pred             HHHHHhhhhHHHHHHHHHh
Q psy16324        216 YLILALVVPIVLFFGSLTI  234 (251)
Q Consensus       216 ~Li~a~~VP~vlFvvS~i~  234 (251)
                      --+|+++||.|.|+.|...
T Consensus        19 lavH~lavPtVfflGaI~a   37 (43)
T TIGR01333        19 LAIHALAIPTVFFFGAITA   37 (43)
T ss_pred             hhhhcccCCceeeccHHHH
Confidence            4589999999999877654


No 62 
>PLN02601 beta-carotene hydroxylase
Probab=21.14  E-value=69  Score=30.90  Aligned_cols=23  Identities=4%  Similarity=0.033  Sum_probs=11.6

Q ss_pred             HHHhhhhHHHHHHHHHHHHHHHH
Q psy16324         42 LQKAKFYVSLCSGVTACLSAFAF   64 (251)
Q Consensus        42 ~ek~~FYttl~l~~tavlSlfaf   64 (251)
                      .|+.-+-.++...-+||.|+.++
T Consensus        91 ~er~ty~~aa~~ss~gi~s~a~~  113 (303)
T PLN02601         91 SERFTYLIAAVMSSFGITSMAIM  113 (303)
T ss_pred             hhhhHHHHHHHHHhhcHHHHHHH
Confidence            34444445555555566555443


No 63 
>CHL00039 psbF photosystem II protein VI
Probab=20.76  E-value=21  Score=24.92  Aligned_cols=18  Identities=39%  Similarity=0.772  Sum_probs=15.0

Q ss_pred             HHHHhhhhHHHHHHHHHh
Q psy16324        217 LILALVVPIVLFFGSLTI  234 (251)
Q Consensus       217 Li~a~~VP~vlFvvS~i~  234 (251)
                      -+|+++||.|.|+-|...
T Consensus        16 avh~lavPtvfflGai~a   33 (39)
T CHL00039         16 AVHGLAVPTVFFLGSISA   33 (39)
T ss_pred             hhhcccCCceeeccHHHH
Confidence            589999999999877654


No 64 
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=20.39  E-value=42  Score=33.24  Aligned_cols=13  Identities=23%  Similarity=0.866  Sum_probs=11.6

Q ss_pred             hhccCCcCCCCCC
Q psy16324        237 YWYCPRKSKVQPA  249 (251)
Q Consensus       237 ~~~C~~~~k~~~~  249 (251)
                      -|+||+|+|.||+
T Consensus       284 ~W~CpkC~~k~ss  296 (415)
T COG5533         284 AWRCPKCGRKESS  296 (415)
T ss_pred             cccCchhcccccc
Confidence            3999999999986


No 65 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=20.34  E-value=55  Score=22.75  Aligned_cols=24  Identities=17%  Similarity=0.126  Sum_probs=15.9

Q ss_pred             hHHHHHHHHHhhhhhccCCcCCCC
Q psy16324        224 PIVLFFGSLTILGYWYCPRKSKVQ  247 (251)
Q Consensus       224 P~vlFvvS~i~L~~~~C~~~~k~~  247 (251)
                      -.|+-+++++++|+++-.||-|..
T Consensus        10 v~V~vg~~iiii~~~~YaCcykk~   33 (38)
T PF02439_consen   10 VAVVVGMAIIIICMFYYACCYKKH   33 (38)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHccc
Confidence            345666777778888877665543


No 66 
>KOG1792|consensus
Probab=20.29  E-value=1.1e+02  Score=28.18  Aligned_cols=31  Identities=23%  Similarity=0.277  Sum_probs=24.1

Q ss_pred             hHHHHH-HHHHHHHHHHHHhhhhhhhchhHHH
Q psy16324         48 YVSLCS-GVTACLSAFAFLFLIPFIIEPAIKT   78 (251)
Q Consensus        48 Yttl~l-~~tavlSlfafLFLvPfvvdPAist   78 (251)
                      |.|.++ ++|-...++..+|.||.++|+.-..
T Consensus       164 ~vGs~fn~lTll~ig~v~~~TvP~~YEky~d~  195 (230)
T KOG1792|consen  164 YVGSLFNFLTLLYIGLVLLFTVPVLYEKYEDQ  195 (230)
T ss_pred             HHHHhhhHHHHHHHHHHHHhcccchhHHhHHH
Confidence            456566 7778888899999999999876544


Done!