BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy16333
         (192 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1SQS|A Chain A, X-Ray Crystal Structure Protein Sp1951 Of Streptococcus
           Pneumoniae. Northeast Structural Genomics Consortium
           Target Spr27.
 pdb|1SQS|B Chain B, X-Ray Crystal Structure Protein Sp1951 Of Streptococcus
           Pneumoniae. Northeast Structural Genomics Consortium
           Target Spr27.
 pdb|2OYS|A Chain A, Crystal Structure Of Sp1951 Protein From Streptococcus
           Pneumoniae In Complex With Fmn, Northeast Structural
           Genomics Target Spr27
 pdb|2OYS|B Chain B, Crystal Structure Of Sp1951 Protein From Streptococcus
           Pneumoniae In Complex With Fmn, Northeast Structural
           Genomics Target Spr27
          Length = 242

 Score = 32.7 bits (73), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 56  LLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAF 91
           LL ++I I S+P+YL +V+V      +R GG  H F
Sbjct: 77  LLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLF 112


>pdb|3N0A|A Chain A, Crystal Structure Of Auxilin (40-400)
          Length = 361

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 43  TPPLTLYVDYFSGLLSAN-IRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCV 101
           +P    Y+ Y   LL+    R +  PL +  +TV   P F++   GC  +  +  G   +
Sbjct: 163 SPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPVPFFNKQRNGCRPYCDVLIGETKI 222

Query: 102 YTS 104
           YT+
Sbjct: 223 YTT 225


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.142    0.438 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,394,766
Number of Sequences: 62578
Number of extensions: 210440
Number of successful extensions: 486
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 485
Number of HSP's gapped (non-prelim): 2
length of query: 192
length of database: 14,973,337
effective HSP length: 93
effective length of query: 99
effective length of database: 9,153,583
effective search space: 906204717
effective search space used: 906204717
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)