BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy16333
(192 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1SQS|A Chain A, X-Ray Crystal Structure Protein Sp1951 Of Streptococcus
Pneumoniae. Northeast Structural Genomics Consortium
Target Spr27.
pdb|1SQS|B Chain B, X-Ray Crystal Structure Protein Sp1951 Of Streptococcus
Pneumoniae. Northeast Structural Genomics Consortium
Target Spr27.
pdb|2OYS|A Chain A, Crystal Structure Of Sp1951 Protein From Streptococcus
Pneumoniae In Complex With Fmn, Northeast Structural
Genomics Target Spr27
pdb|2OYS|B Chain B, Crystal Structure Of Sp1951 Protein From Streptococcus
Pneumoniae In Complex With Fmn, Northeast Structural
Genomics Target Spr27
Length = 242
Score = 32.7 bits (73), Expect = 0.14, Method: Compositional matrix adjust.
Identities = 15/36 (41%), Positives = 22/36 (61%)
Query: 56 LLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAF 91
LL ++I I S+P+YL +V+V +R GG H F
Sbjct: 77 LLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLF 112
>pdb|3N0A|A Chain A, Crystal Structure Of Auxilin (40-400)
Length = 361
Score = 28.5 bits (62), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
Query: 43 TPPLTLYVDYFSGLLSAN-IRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCV 101
+P Y+ Y LL+ R + PL + +TV P F++ GC + + G +
Sbjct: 163 SPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPVPFFNKQRNGCRPYCDVLIGETKI 222
Query: 102 YTS 104
YT+
Sbjct: 223 YTT 225
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.142 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,394,766
Number of Sequences: 62578
Number of extensions: 210440
Number of successful extensions: 486
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 485
Number of HSP's gapped (non-prelim): 2
length of query: 192
length of database: 14,973,337
effective HSP length: 93
effective length of query: 99
effective length of database: 9,153,583
effective search space: 906204717
effective search space used: 906204717
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)