Query         psy16333
Match_columns 192
No_of_seqs    125 out of 448
Neff          6.5 
Searched_HMMs 46136
Date          Fri Aug 16 18:43:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16333.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16333hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10409 PTEN_C2:  C2 domain of 100.0 4.5E-29 9.8E-34  192.6  10.4  118   63-191     1-126 (134)
  2 KOG2283|consensus               99.9 8.7E-28 1.9E-32  217.6  12.0  166    6-183   105-300 (434)
  3 PTZ00393 protein tyrosine phos  98.6 2.8E-08   6E-13   84.2   2.0   51    8-59    170-231 (241)
  4 PTZ00242 protein tyrosine phos  98.5   3E-08 6.6E-13   79.6   1.2   50    8-58     98-159 (166)
  5 KOG1720|consensus               98.4 1.3E-07 2.7E-12   78.6   2.3   51    6-56    145-207 (225)
  6 COG2453 CDC14 Predicted protei  98.3 1.9E-07 4.1E-12   75.8   1.6   57    2-58     98-168 (180)
  7 PF00782 DSPc:  Dual specificit  98.2 4.2E-07   9E-12   69.0   0.4   52    4-55     68-132 (133)
  8 smart00195 DSPc Dual specifici  98.0 2.5E-06 5.3E-11   65.3   1.8   47    9-55     79-137 (138)
  9 smart00404 PTPc_motif Protein   98.0   2E-06 4.4E-11   61.6   0.6   21    8-28     39-59  (105)
 10 smart00012 PTPc_DSPc Protein t  98.0   2E-06 4.4E-11   61.6   0.6   21    8-28     39-59  (105)
 11 KOG1719|consensus               97.6 4.1E-05 8.8E-10   61.3   2.1   50    9-58    110-172 (183)
 12 cd00127 DSPc Dual specificity   97.5 3.5E-05 7.6E-10   58.4   1.1   20    9-28     82-101 (139)
 13 PRK12361 hypothetical protein;  97.4 7.6E-05 1.6E-09   70.0   2.0   52    4-55    170-235 (547)
 14 PHA02747 protein tyrosine phos  96.7 0.00055 1.2E-08   60.1   0.8   41   10-50    231-288 (312)
 15 PHA02740 protein tyrosine phos  96.6  0.0007 1.5E-08   59.2   0.7   44    9-52    222-282 (298)
 16 PHA02742 protein tyrosine phos  96.6 0.00076 1.7E-08   59.0   0.7   44    9-52    230-290 (303)
 17 PHA02746 protein tyrosine phos  96.5 0.00095 2.1E-08   58.9   1.1   44    9-52    248-308 (323)
 18 PHA02738 hypothetical protein;  96.4   0.001 2.2E-08   58.7   0.8   43   10-52    229-288 (320)
 19 COG5599 PTP2 Protein tyrosine   96.1  0.0032 6.9E-08   54.5   2.0   22    7-28    217-238 (302)
 20 KOG0792|consensus               96.1   0.002 4.4E-08   64.1   0.7   42   10-51   1065-1123(1144)
 21 KOG0790|consensus               95.8  0.0044 9.6E-08   57.0   1.7   45    9-53    452-516 (600)
 22 cd00047 PTPc Protein tyrosine   95.8  0.0038 8.2E-08   51.7   1.1   26    8-33    166-193 (231)
 23 smart00194 PTPc Protein tyrosi  95.8  0.0042 9.1E-08   52.4   1.3   28    8-35    193-222 (258)
 24 KOG0789|consensus               95.5  0.0046 9.9E-08   55.3   0.7   45    9-53    300-362 (415)
 25 PF03162 Y_phosphatase2:  Tyros  95.5  0.0037   8E-08   50.2  -0.1   43    9-55     92-148 (164)
 26 PRK15375 pathogenicity island   95.1  0.0057 1.2E-07   57.2  -0.1   18   11-28    469-486 (535)
 27 PF00102 Y_phosphatase:  Protei  94.0   0.014   3E-07   47.5  -0.2   28    8-35    170-199 (235)
 28 COG2365 Protein tyrosine/serin  93.9   0.017 3.8E-07   49.2   0.1   20    9-28    137-156 (249)
 29 KOG2836|consensus               92.6   0.034 7.3E-07   43.9  -0.0   44    9-53     98-152 (173)
 30 TIGR01244 conserved hypothetic  91.9   0.044 9.6E-07   42.3  -0.2   19    9-28     87-105 (135)
 31 KOG1716|consensus               91.2    0.13 2.8E-06   44.5   2.1   51    9-59    156-218 (285)
 32 KOG2283|consensus               90.6    0.14 3.1E-06   47.2   1.8   55  138-192   111-165 (434)
 33 KOG4228|consensus               90.2    0.23   5E-06   50.2   3.0   20    9-28    731-750 (1087)
 34 KOG2386|consensus               90.0    0.17 3.8E-06   46.0   1.8   38    5-42    121-170 (393)
 35 KOG0793|consensus               90.0    0.18   4E-06   49.0   2.0   19   10-28    929-947 (1004)
 36 KOG0791|consensus               89.4    0.19   4E-06   45.3   1.5   20    9-28    288-307 (374)
 37 PLN02727 NAD kinase             87.1    0.19 4.2E-06   50.2   0.1   21    8-28    341-361 (986)
 38 KOG1572|consensus               85.9    0.29 6.4E-06   41.7   0.6   20    9-28    149-168 (249)
 39 KOG4471|consensus               85.3    0.25 5.4E-06   47.2  -0.1   22    9-30    375-396 (717)
 40 KOG4228|consensus               72.3     2.4 5.2E-05   43.2   2.1   21    8-28   1018-1038(1087)
 41 PF06602 Myotub-related:  Myotu  71.5     1.8 3.9E-05   38.8   0.9   27    2-28    223-251 (353)
 42 KOG1717|consensus               62.1     3.4 7.4E-05   36.2   0.8   27    2-28    244-271 (343)
 43 cd04054 C2A_Rasal1_RasA4 C2 do  57.6      27 0.00058   25.7   4.9   38   68-106     2-39  (121)
 44 KOG1718|consensus               54.9     4.5 9.8E-05   33.2   0.3   23    6-28     92-114 (198)
 45 cd08393 C2A_SLP-1_2 C2 domain   53.2      25 0.00054   26.1   4.1   31   66-96     15-45  (125)
 46 cd08401 C2A_RasA2_RasA3 C2 dom  52.1      32 0.00069   25.5   4.5   39   68-106     2-40  (121)
 47 cd04042 C2A_MCTP_PRT C2 domain  50.2      41  0.0009   24.5   4.9   68   68-144     2-72  (121)
 48 KOG1089|consensus               44.8     8.6 0.00019   36.8   0.5   26    3-28    337-364 (573)
 49 cd08382 C2_Smurf-like C2 domai  43.3 1.3E+02  0.0028   22.0   6.8   37   69-106     3-39  (123)
 50 PF00168 C2:  C2 domain;  Inter  40.8      99  0.0021   20.0   8.4   72   69-146     2-76  (85)
 51 cd04041 C2A_fungal C2 domain f  40.1 1.4E+02   0.003   21.4   7.1   39   68-106     3-43  (111)
 52 cd08685 C2_RGS-like C2 domain   38.7      53  0.0012   24.3   3.9   32   64-97     10-41  (119)
 53 PRK15378 inositol phosphate ph  37.6      21 0.00045   33.8   1.8   20    9-28    457-476 (564)
 54 cd08688 C2_KIAA0528-like C2 do  36.9      85  0.0018   22.5   4.7   35   70-105     3-37  (110)
 55 COG5350 Predicted protein tyro  36.7      18  0.0004   29.2   1.1   19    5-23     90-108 (172)
 56 cd04045 C2C_Tricalbin-like C2   36.4      84  0.0018   23.1   4.7   36   70-106     5-40  (120)
 57 cd04040 C2D_Tricalbin-like C2   34.2      75  0.0016   22.6   4.1   33   73-106     6-38  (115)
 58 cd08387 C2A_Synaptotagmin-8 C2  34.1 1.8E+02  0.0039   21.0   9.1   40   66-106    16-57  (124)
 59 cd08392 C2A_SLP-3 C2 domain fi  33.9      76  0.0016   23.8   4.2   31   66-96     15-45  (128)
 60 cd08406 C2B_Synaptotagmin-12 C  33.4      85  0.0018   23.9   4.4   31   65-96     14-44  (136)
 61 cd08383 C2A_RasGAP C2 domain (  32.8      98  0.0021   22.0   4.5   33   70-106     4-36  (117)
 62 cd04030 C2C_KIAA1228 C2 domain  32.2      85  0.0018   22.8   4.1   31   66-97     16-46  (127)
 63 cd04048 C2A_Copine C2 domain f  31.7   2E+02  0.0043   20.8   7.4   27   72-99      6-32  (120)
 64 cd08404 C2B_Synaptotagmin-4 C2  30.5   1E+02  0.0022   23.0   4.4   31   65-96     14-44  (136)
 65 cd08388 C2A_Synaptotagmin-4-11  30.3   1E+02  0.0023   22.9   4.4   32   65-96     15-46  (128)
 66 cd08386 C2A_Synaptotagmin-7 C2  30.2      93   0.002   22.5   4.0   30   66-96     16-45  (125)
 67 cd08381 C2B_PI3K_class_II C2 d  29.9      73  0.0016   23.5   3.4   34   62-97      9-42  (122)
 68 cd08385 C2A_Synaptotagmin-1-5-  29.2   1E+02  0.0022   22.4   4.1   41   65-106    15-57  (124)
 69 PF05925 IpgD:  Enterobacterial  28.9      19  0.0004   34.3   0.0   20    9-28    454-473 (559)
 70 cd08384 C2B_Rabphilin_Doc2 C2   28.6   1E+02  0.0023   22.6   4.1   31   65-96     12-42  (133)
 71 cd04029 C2A_SLP-4_5 C2 domain   28.0 1.2E+02  0.0026   22.5   4.3   32   66-97     15-46  (125)
 72 cd04025 C2B_RasA1_RasA4 C2 dom  26.6 1.7E+02  0.0036   21.2   4.9   32   68-100     2-33  (123)
 73 cd04022 C2A_MCTP_PRT_plant C2   26.4 1.6E+02  0.0035   21.5   4.8   33   68-101     2-34  (127)
 74 cd08680 C2_Kibra C2 domain fou  26.1 1.2E+02  0.0026   22.7   4.1   29   66-95     14-42  (124)
 75 cd08403 C2B_Synaptotagmin-3-5-  25.6 1.3E+02  0.0028   22.3   4.1   30   66-96     14-43  (134)
 76 cd04028 C2B_RIM1alpha C2 domai  25.3 1.1E+02  0.0024   23.8   3.8   34   63-96     26-59  (146)
 77 cd08521 C2A_SLP C2 domain firs  25.1 1.3E+02  0.0028   21.6   4.0   31   66-96     14-44  (123)
 78 cd08402 C2B_Synaptotagmin-1 C2  24.8 1.3E+02  0.0029   22.2   4.1   31   65-96     14-44  (136)
 79 PF00741 Gas_vesicle:  Gas vesi  24.2      65  0.0014   19.9   1.8   15  126-140    11-25  (39)
 80 cd08410 C2B_Synaptotagmin-17 C  24.0 1.4E+02  0.0031   22.2   4.2   30   66-96     14-43  (135)
 81 cd04050 C2B_Synaptotagmin-like  23.2 1.9E+02  0.0042   20.3   4.6   31   69-100     3-33  (105)
 82 cd04026 C2_PKC_alpha_gamma C2   23.0   3E+02  0.0066   20.0   7.0   34   63-97     10-43  (131)
 83 cd08376 C2B_MCTP_PRT C2 domain  22.4 2.4E+02  0.0053   20.0   5.0   29   71-100     5-33  (116)
 84 cd08390 C2A_Synaptotagmin-15-1  22.3 1.5E+02  0.0033   21.3   3.9   31   66-96     14-44  (123)
 85 cd08405 C2B_Synaptotagmin-7 C2  22.3 1.6E+02  0.0034   21.8   4.1   30   66-96     15-44  (136)
 86 cd08408 C2B_Synaptotagmin-14_1  22.2 1.5E+02  0.0032   22.5   3.9   30   66-96     15-44  (138)
 87 cd08409 C2B_Synaptotagmin-15 C  22.1 1.7E+02  0.0036   22.0   4.2   29   66-96     15-43  (137)
 88 cd04046 C2_Calpain C2 domain p  21.9 1.9E+02  0.0041   21.2   4.4   24   77-101    14-37  (126)
 89 cd04031 C2A_RIM1alpha C2 domai  21.9 1.6E+02  0.0036   21.1   4.0   31   66-97     16-46  (125)
 90 cd04037 C2E_Ferlin C2 domain f  21.6 3.3E+02  0.0072   19.9   8.1   30   70-100     4-33  (124)
 91 cd04017 C2D_Ferlin C2 domain f  21.5   2E+02  0.0044   21.3   4.6   32   68-100     3-34  (135)
 92 cd04024 C2A_Synaptotagmin-like  21.5 2.3E+02   0.005   20.3   4.8   33   70-104     5-39  (128)
 93 cd08677 C2A_Synaptotagmin-13 C  21.4 1.6E+02  0.0035   22.2   4.0   28   66-97     14-41  (118)
 94 cd04035 C2A_Rabphilin_Doc2 C2   21.3 1.7E+02  0.0038   21.1   4.1   30   66-96     15-44  (123)
 95 COG0161 BioA Adenosylmethionin  21.2      47   0.001   31.0   1.1   27    2-28    241-270 (449)
 96 cd04027 C2B_Munc13 C2 domain s  21.0   2E+02  0.0043   21.1   4.4   31   69-100     4-34  (127)
 97 cd08682 C2_Rab11-FIP_classI C2  20.7 1.9E+02   0.004   21.1   4.2   27   74-101     7-33  (126)

No 1  
>PF10409 PTEN_C2:  C2 domain of PTEN tumour-suppressor protein;  InterPro: IPR014020 Tensins constitute an eukaryotic family of lipid phosphatases that are defined by the presence of two adjacent domains: a lipid phosphatase domain and a C2-like domain. The tensin-type C2 domain has a structure similar to the classical C2 domain (see IPR000008 from INTERPRO) that mediates the Ca2+-dependent membrane recruitment of several signalling proteins. However the tensin-type C2 domain lacks two of the three conserved loops that bind Ca2+, and in this respect it is similar to the C2 domains of PKC-type [, ]. The tensin-type C2 domain can bind phopholipid membranes in a Ca2+ independent manner []. In the tumour suppressor protein PTEN, the best characterised member of the family, the lipid phosphatase domain was shown to specifically dephosphorylate the D3 position of the inositol ring of the lipid second messenger, phosphatydilinositol-3-4-5-triphosphate (PIP3). The lipid phosphatase domain contains the signature motif HCXXGXXR present in the active sites of protein tyrosine phosphatases (PTPs) and dual specificity phosphatases (DSPs). Furthermore, two invariant lysines are found only in the tensin-type phosphatase motif (HCKXGKXR) and are suspected to interact with the phosphate group at position D1 and D5 of the inositol ring [, ].  The C2 domain is found at the C terminus of the tumour suppressor protein PTEN (phosphatidyl-inositol triphosphate phosphatase). This domain may include a CBR3 loop, indicating a central role in membrane binding. This domain associates across an extensive interface with the N-terminal phosphatase domain DSPc suggesting that the C2 domain productively positions the catalytic part of the protein on the membrane. The crystal structure of the PTEN tumour suppressor has been solved []. The lipid phosphatase domain has a structure similar to the dual specificity phosphatase (see IPR000387 from INTERPRO). However, PTEN has a larger active site pocket that could be important to accommodate PI(3,4,5)P3.  Proteins known to contain a phosphatase and a C2 tensin-type domain are listed below:   Tensin, a focal-adhesion molecule that binds to actin filaments. It may be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.   Phosphatase and tensin homologue deleted on chromosome 10 protein (PTEN). It antagonizes PI 3-kinase signalling by dephosphorylating the 3-position of the inositol ring of PI(3,4,5)P3 and thus inactivates downstream signalling. It plays major roles both during development and in the adult to control cell size, growth, and survival.   Auxilin. It binds clathrin heavy chain and promotes its assembly into regular cages.   Cyclin G-associated kinase or auxilin-2. It is a potential regulator of clathrin-mediated membrane trafficking. ; GO: 0005515 protein binding; PDB: 3N0A_A 1D5R_A 3V0D_B 3V0H_B 3V0G_A 3V0F_B 3V0J_A 3V0I_A 3AWE_B 3AWG_C ....
Probab=99.96  E-value=4.5e-29  Score=192.63  Aligned_cols=118  Identities=27%  Similarity=0.428  Sum_probs=91.8

Q ss_pred             CCCCCeEEEEEEEecCCCCCCCCCceeEEEEEEecceeEee-ccccccCCCc-ceeEEEEeccccccCceEecCeEEEEE
Q psy16333         63 INSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYT-SGVHGVGSEA-RQFTVNVAGERQRRGLQLRGDILLKCY  140 (192)
Q Consensus        63 ~~~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~t-S~~~~~~~~~-~~~~~~~~~~~~~~~~~l~GDI~V~~y  140 (192)
                      |++++|.|++|+|+++|.|+. ++||+||++||++.+.+++ +..++..... .....+.+..    +++|+|||+|+||
T Consensus         1 ~~~~~l~L~~I~l~~iP~f~~-~~gc~p~i~I~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~----~~~l~GDV~i~~~   75 (134)
T PF10409_consen    1 PPPRPLFLKSIILHGIPNFNS-GGGCRPYIEIYNGGKKVFSTSKSYEDPKSYEQDSVIIELPK----NLPLRGDVLIKFY   75 (134)
T ss_dssp             -S--EEEEEEEEEES-TTSTT-SSCCTEEEEEEETTEEEEETCCTCCCCCEEETTCEEEEEEE----EEEEESEEEEEEE
T ss_pred             CCCeeEEEEEEEEECCCccCC-CCCEEEEEEEECCCccEEEeccceeccccccceeEEEEeCC----CCeEeCCEEEEEE
Confidence            578899999999999999976 5899999999999999964 4444432211 1222333322    7899999999999


Q ss_pred             EcC--CCceeEEEEeeeeeeeccccCc--CccccchhchhhhccccCC--CCCCCCC
Q psy16333        141 HRG--NKDRIGVVVSAYMHYSNICGTA--DQALDRFAMKRFLDDKIGD--LDFPSYK  191 (192)
Q Consensus       141 h~~--~~~~~~mF~~~~F~~~hT~fi~--~~~L~~~~~K~eLD~a~kd--~rfp~~~  191 (192)
                      |++  ...++.||++| |   |||||+  ++.|.|  .|+|||+|+||  ++||++.
T Consensus        76 ~~~~~~~~~~~~f~~~-F---nT~Fi~~~~~~l~~--~k~eLD~~~kdk~k~f~~~f  126 (134)
T PF10409_consen   76 HKRSSSMSKEKMFRFW-F---NTGFIEPNNNVLRF--TKSELDKAHKDKHKRFPPDF  126 (134)
T ss_dssp             ECETTECCCEEEEEEE-E---EGGGSBTTTCEEEE--EGGGSBTCCCGCTCCS-TT-
T ss_pred             eCCCcccccCeEEEEE-E---eeeeeeccccEEEc--CHHHCCCcccCcccccCCCe
Confidence            998  55678899999 9   999999  899999  99999999999  9999985


No 2  
>KOG2283|consensus
Probab=99.95  E-value=8.7e-28  Score=217.57  Aligned_cols=166  Identities=21%  Similarity=0.308  Sum_probs=121.2

Q ss_pred             hcCCeEEEEcCCCCCceeeeecc-------------ccccccccC---C--CCCcCcchhhHHHHHHh-hhcCcccCCCC
Q psy16333          6 LRSQSDLKKCHPSLPYTGVMVSS-------------PMNRPFIDN---I--FPIATPPLTLYVDYFSG-LLSANIRINSA   66 (192)
Q Consensus         6 ~~~nv~vihC~~G~grtg~~i~~-------------a~~~~~~~~---~--~~~~~PSq~RYv~Y~~~-ll~~~~~~~~~   66 (192)
                      ..+|||||||||||||||+||||             |++.|..+|   .  .++++|||+|||+||+. ++++.++++.+
T Consensus       105 d~~nVvvvHCk~Gkgrtg~~icA~L~~~~~~~ta~eald~~~~kR~~~~~~~~~~~PSq~RYv~Y~~~~l~~~~~~~~~~  184 (434)
T KOG2283|consen  105 DPKNVVVVHCKAGKGRTGVMICAYLIYSGISATAEEALDYFNEKRFDEGKSKGVTIPSQRRYVGYFSRVLLNGPLPPRSN  184 (434)
T ss_pred             CccceEEEEccCCCcceEEEEeHHHHhhhhcCCHHHHHHHHhhhhccccccCCccCchhhHHHHHHHHHhhcCCcCcccc
Confidence            34499999999999999999999             566666666   3  68999999999999999 77888888887


Q ss_pred             --CeEEEEEEEecCCCCCCCCCceeEEEEEEecceeEeeccccccCCCcceeEEEEeccccccCceEecCeEEEEEEcC-
Q psy16333         67 --PLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRG-  143 (192)
Q Consensus        67 --~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~~~~~~~~~~~~~~~~~~~~~~~~~l~GDI~V~~yh~~-  143 (192)
                        +++|++++++++|+++..+++|+|+++||++++.++++............-.++++.    ++.+.    ++|||++ 
T Consensus       185 ~~~~f~~~~~~~~ip~~~~~~~~~~~~~~v~~~k~~~~~~~s~~~~~~~~~~g~~~i~~----~~~~~----~~~~~~~~  256 (434)
T KOG2283|consen  185 SCPLFLHSFILISIPNFNSSRDGCRPAFPVYQGKKKVYSFSSDGIMRLGELDGKIVIPL----GLRVD----VKCYHKRT  256 (434)
T ss_pred             cCceEeeeeeeeecCcccccCCCCCccceeeecceeeEEeccCCcccccccccceeccc----ccccc----eEEEeecc
Confidence              999999999999998777899999999999999999876644321111122222221    45555    8999998 


Q ss_pred             -CCce-------eEEEEeeeeeeeccccCcCccccchhchhhhccccC
Q psy16333        144 -NKDR-------IGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIG  183 (192)
Q Consensus       144 -~~~~-------~~mF~~~~F~~~hT~fi~~~~L~~~~~K~eLD~a~k  183 (192)
                       ...+       ...|.++ |   +|+++....+.....+.+++...+
T Consensus       257 ~~~~~~~~~~~~~~~~~~~-~---~~~~~~~~~~~~~~~~~~~~~~~~  300 (434)
T KOG2283|consen  257 SSGNRGILKDKEFKGCQIQ-F---YTGPFPEDETVVRFFQADLPIYVS  300 (434)
T ss_pred             ccCCcceeeccccceEEEe-c---cCCCccccceeeecccccCCcccc
Confidence             2222       2356667 6   888775433222115666665444


No 3  
>PTZ00393 protein tyrosine phosphatase; Provisional
Probab=98.55  E-value=2.8e-08  Score=84.23  Aligned_cols=51  Identities=10%  Similarity=-0.005  Sum_probs=43.4

Q ss_pred             CCeEEEEcCCCCCceeeeecc-----------ccccccccCCCCCcCcchhhHHHHHHhhhcC
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS-----------PMNRPFIDNIFPIATPPLTLYVDYFSGLLSA   59 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~-----------a~~~~~~~~~~~~~~PSq~RYv~Y~~~ll~~   59 (192)
                      +..|+|||++|.||||+|+|+           |++.+...|+.++ .+.|.+||.-|..-.++
T Consensus       170 g~~VaVHC~AGlGRTGtl~AayLI~~GmspeeAI~~VR~~RPgAI-n~~Q~~fL~~y~~~~~k  231 (241)
T PTZ00393        170 NRAVAVHCVAGLGRAPVLASIVLIEFGMDPIDAIVFIRDRRKGAI-NKRQLQFLKAYKKKKKK  231 (241)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHCCCCC-CHHHHHHHHHHHHhccc
Confidence            378999999999999999999           6777778888776 58999999999876543


No 4  
>PTZ00242 protein tyrosine phosphatase; Provisional
Probab=98.51  E-value=3e-08  Score=79.65  Aligned_cols=50  Identities=8%  Similarity=0.038  Sum_probs=42.2

Q ss_pred             CCeEEEEcCCCCCceeeeecc------------ccccccccCCCCCcCcchhhHHHHHHhhhc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIFPIATPPLTLYVDYFSGLLS   58 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~~~~~PSq~RYv~Y~~~ll~   58 (192)
                      ++.++|||++|.||||+++|+            |++.+...|+..+ .+.|.+||+.|...++
T Consensus        98 g~~V~VHC~aGigRSgt~~a~yL~~~~~~s~~eAi~~vr~~R~~~i-~~~Q~~~l~~~~~~~~  159 (166)
T PTZ00242         98 PETIAVHCVAGLGRAPILVALALVEYGGMEPLDAVGFVREKRKGAI-NQTQLQFLKKYKPRKK  159 (166)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHHHhCCCCHHHHHHHHHHHCCCCc-hHHHHHHHHHHHHHhc
Confidence            589999999999999999998            5666667787766 5899999999987554


No 5  
>KOG1720|consensus
Probab=98.41  E-value=1.3e-07  Score=78.61  Aligned_cols=51  Identities=14%  Similarity=0.119  Sum_probs=43.4

Q ss_pred             hcCCeEEEEcCCCCCceeeeecc------------ccccccccCCCCCcCcchhhHHHHHHhh
Q psy16333          6 LRSQSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIFPIATPPLTLYVDYFSGL   56 (192)
Q Consensus         6 ~~~nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~~~~~PSq~RYv~Y~~~l   56 (192)
                      ++...++|||+||.||||+||||            |++....-|+++|..|-|.-++.-|..+
T Consensus       145 ~~~g~iaVHCkaGlGRTG~liAc~lmy~~g~ta~eaI~~lR~~RpG~V~gpqQ~~l~~~q~~~  207 (225)
T KOG1720|consen  145 EKGGKIAVHCKAGLGRTGTLIACYLMYEYGMTAGEAIAWLRICRPGAVIGPQQHKLLHKQRDL  207 (225)
T ss_pred             HhcCeEEEEeccCCCchhHHHHHHHHHHhCCCHHHHHHHHHhcCCccccCHHHHHHHHHHHHH
Confidence            34578999999999999999999            4555555689999999999999988884


No 6  
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms]
Probab=98.33  E-value=1.9e-07  Score=75.76  Aligned_cols=57  Identities=11%  Similarity=0.050  Sum_probs=42.4

Q ss_pred             hhhHhcC-CeEEEEcCCCCCceeeeecc------------ccccccccCCC-CCcCcchhhHHHHHHhhhc
Q psy16333          2 VLELLRS-QSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIF-PIATPPLTLYVDYFSGLLS   58 (192)
Q Consensus         2 ~~~~~~~-nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~-~~~~PSq~RYv~Y~~~ll~   58 (192)
                      |.+++++ ..|+|||++|.|||||++++            +...+..++.. ++..+.|.+|.........
T Consensus        98 i~~~~~~g~kVvVHC~~GigRSgtviaA~lm~~~~~~~~~~~i~~~~~~r~~~v~~~~q~~~~~e~~~~~~  168 (180)
T COG2453          98 IEEALSKGKKVVVHCQGGIGRSGTVIAAYLMLYGGLSLADEAIAVKRRRRPGAVVTEIQHLFELEQELFRK  168 (180)
T ss_pred             HHHHHhcCCeEEEEcCCCCchHHHHHHHHHHHHcCCCCHHHHHHHHHhcCCcccccHHHHHHHHHHHHHHh
Confidence            4566667 59999999999999999997            12233334444 8999999998887776554


No 7  
>PF00782 DSPc:  Dual specificity phosphatase, catalytic domain;  InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity. Consequently, maintaining an appropriate level of protein tyrosine phosphorylation is essential for many cellular functions. Tyrosine-specific protein phosphatases (PTPase; 3.1.3.48 from EC) catalyse the removal of a phosphate group attached to a tyrosine residue, using a cysteinyl-phosphate enzyme intermediate. These enzymes are key regulatory components in signal transduction pathways (such as the MAP kinase pathway) and cell cycle control, and are important in the control of cell growth, proliferation, differentiation and transformation [, ]. The PTP superfamily can be divided into four subfamilies []:   (1) pTyr-specific phosphatases (2) dual specificity phosphatases (dTyr and dSer/dThr) (3) Cdc25 phosphatases (dTyr and/or dThr) (4) LMW (low molecular weight) phosphatases   Based on their cellular localisation, PTPases are also classified as:   Receptor-like, which are transmembrane receptors that contain PTPase domains [] Non-receptor (intracellular) PTPases []   All PTPases carry the highly conserved active site motif C(X)5R (PTP signature motif), employ a common catalytic mechanism, and share a similar core structure made of a central parallel beta-sheet with flanking alpha-helices containing a beta-loop-alpha-loop that encompasses the PTP signature motif []. Functional diversity between PTPases is endowed by regulatory domains and subunits.  This entry represents dual specificity protein-tyrosine phosphatases. Ser/Thr and Tyr dual specificity phosphatases are a group of enzymes with both Ser/Thr (3.1.3.16 from EC) and tyrosine specific protein phosphatase (3.1.3.48 from EC) activity able to remove both the serine/threonine or tyrosine-bound phosphate group from a wide range of phosphoproteins, including a number of enzymes which have been phosphorylated under the action of a kinase. Dual specificity protein phosphatases (DSPs) regulate mitogenic signal transduction and control the cell cycle. The crystal structure of a human DSP, vaccinia H1-related phosphatase (or VHR), has been determined at 2.1 angstrom resolution []. A shallow active site pocket in VHR allows for the hydrolysis of phosphorylated serine, threonine, or tyrosine protein residues, whereas the deeper active site of protein tyrosine phosphatases (PTPs) restricts substrate specificity to only phosphotyrosine. Positively charged crevices near the active site may explain the enzyme's preference for substrates with two phosphorylated residues. The VHR structure defines a conserved structural scaffold for both DSPs and PTPs. A "recognition region" connecting helix alpha1 to strand beta1, may determine differences in substrate specificity between VHR, the PTPs, and other DSPs. These proteins may also have inactive phosphatase domains, and dependent on the domain composition this loss of catalytic activity has different effects on protein function. Inactive single domain phosphatases can still specifically bind substrates, and protect again dephosphorylation, while the inactive domains of tandem phosphatases can be further subdivided into two classes. Those which bind phosphorylated tyrosine residues may recruit multi-phosphorylated substrates for the adjacent active domains and are more conserved, while the other class have accumulated several variable amino acid substitutions and have a complete loss of tyrosine binding capability. The second class shows a release of evolutionary constraint for the sites around the catalytic centre, which emphasises a difference in function from the first group. There is a region of higher conservation common to both classes, suggesting a new regulatory centre [].; GO: 0008138 protein tyrosine/serine/threonine phosphatase activity, 0006470 protein dephosphorylation; PDB: 2G6Z_A 1MKP_A 1YZ4_A 2P4D_A 1M3G_A 1ZZW_A 2OUD_A 2HXP_A 3LJ8_A 1OHD_A ....
Probab=98.17  E-value=4.2e-07  Score=68.96  Aligned_cols=52  Identities=10%  Similarity=0.133  Sum_probs=41.8

Q ss_pred             hHhcC-CeEEEEcCCCCCceeeeecc------------ccccccccCCCCCcCcchhhHHHHHHh
Q psy16333          4 ELLRS-QSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIFPIATPPLTLYVDYFSG   55 (192)
Q Consensus         4 ~~~~~-nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~~~~~PSq~RYv~Y~~~   55 (192)
                      ++.++ ..|.|||++|.+|||+++++            |++.+...|+.....|+|.+.|.-|++
T Consensus        68 ~~~~~~~~VlVHC~~G~~RS~~v~~ayLm~~~~~~~~~A~~~v~~~rp~~~~~~~~~~~L~~~e~  132 (133)
T PF00782_consen   68 NAISEGGKVLVHCKAGLSRSGAVAAAYLMKKNGMSLEEAIEYVRSRRPQINPNPSFIRQLYEYEK  132 (133)
T ss_dssp             HHHHTTSEEEEEESSSSSHHHHHHHHHHHHHHTSSHHHHHHHHHHHSTTSTHHHHHHHHHHHHHH
T ss_pred             hhhcccceeEEEeCCCcccchHHHHHHHHHHcCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHhhc
Confidence            34444 79999999999999999999            666777788666666789999987764


No 8  
>smart00195 DSPc Dual specificity phosphatase, catalytic domain.
Probab=98.01  E-value=2.5e-06  Score=65.28  Aligned_cols=47  Identities=4%  Similarity=-0.025  Sum_probs=37.7

Q ss_pred             CeEEEEcCCCCCceeeeecc------------ccccccccCCCCCcCcchhhHHHHHHh
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIFPIATPPLTLYVDYFSG   55 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~~~~~PSq~RYv~Y~~~   55 (192)
                      ..++|||++|.||||+++++            |++.+...|+.....+.|.+-|.-|++
T Consensus        79 ~~VlVHC~~G~~RS~~v~~~yl~~~~~~~~~~A~~~v~~~R~~~~p~~~~~~qL~~~e~  137 (138)
T smart00195       79 GKVLVHCQAGVSRSATLIIAYLMKYRNLSLNDAYDFVKDRRPIISPNFGFLRQLIEYER  137 (138)
T ss_pred             CeEEEECCCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHCCccCCCHhHHHHHHHHhh
Confidence            78999999999999999888            566666677666667788888776654


No 9  
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif.
Probab=97.97  E-value=2e-06  Score=61.57  Aligned_cols=21  Identities=24%  Similarity=0.365  Sum_probs=19.2

Q ss_pred             CCeEEEEcCCCCCceeeeecc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~   28 (192)
                      ++-++|||++|.||||+++++
T Consensus        39 ~~pvlVHC~~G~gRtg~~~~~   59 (105)
T smart00404       39 SGPVVVHCSAGVGRTGTFVAL   59 (105)
T ss_pred             CCCEEEEeCCCCChhhHHHHH
Confidence            468999999999999999887


No 10 
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity. Protein tyrosine phosphatases. Homologues detected by this profile and not by those of "PTPc" or  "DSPc" are predicted to be protein phosphatases with a similar fold to DSPs and PTPs, yet with unpredicted specificities.
Probab=97.97  E-value=2e-06  Score=61.57  Aligned_cols=21  Identities=24%  Similarity=0.365  Sum_probs=19.2

Q ss_pred             CCeEEEEcCCCCCceeeeecc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~   28 (192)
                      ++-++|||++|.||||+++++
T Consensus        39 ~~pvlVHC~~G~gRtg~~~~~   59 (105)
T smart00012       39 SGPVVVHCSAGVGRTGTFVAL   59 (105)
T ss_pred             CCCEEEEeCCCCChhhHHHHH
Confidence            468999999999999999887


No 11 
>KOG1719|consensus
Probab=97.56  E-value=4.1e-05  Score=61.28  Aligned_cols=50  Identities=6%  Similarity=0.068  Sum_probs=40.8

Q ss_pred             CeEEEEcCCCCCceeeeecc------------ccccccccCCCCCcCcchhhHHHH-HHhhhc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIFPIATPPLTLYVDY-FSGLLS   58 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~~~~~PSq~RYv~Y-~~~ll~   58 (192)
                      ..+-||||||+||++||++|            |.+.....|+.-++-|+|.+=+.= +..++.
T Consensus       110 ktvYVHCKAGRtRSaTvV~cYLmq~~~wtpe~A~~~vr~iRp~VlL~~~Qw~~l~ef~~~~~~  172 (183)
T KOG1719|consen  110 KTVYVHCKAGRTRSATVVACYLMQHKNWTPEAAVEHVRKIRPRVLLRPAQWDVLKEFYKQIVA  172 (183)
T ss_pred             CeEEEEecCCCccchhhhhhhhhhhcCCCHHHHHHHHHhcCcceeecHHHHHHHHHHHHHHHh
Confidence            57889999999999999999            555666778889999999998764 444544


No 12 
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases. Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like.
Probab=97.51  E-value=3.5e-05  Score=58.44  Aligned_cols=20  Identities=15%  Similarity=0.290  Sum_probs=18.7

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      .-++|||.+|.||||+++++
T Consensus        82 ~~vlVHC~~G~~Rs~~~~~~  101 (139)
T cd00127          82 GKVLVHCLAGVSRSATLVIA  101 (139)
T ss_pred             CcEEEECCCCCchhHHHHHH
Confidence            78999999999999999887


No 13 
>PRK12361 hypothetical protein; Provisional
Probab=97.38  E-value=7.6e-05  Score=69.98  Aligned_cols=52  Identities=6%  Similarity=-0.037  Sum_probs=42.8

Q ss_pred             hHhcC-CeEEEEcCCCCCceeeeecc-------------ccccccccCCCCCcCcchhhHHHHHHh
Q psy16333          4 ELLRS-QSDLKKCHPSLPYTGVMVSS-------------PMNRPFIDNIFPIATPPLTLYVDYFSG   55 (192)
Q Consensus         4 ~~~~~-nv~vihC~~G~grtg~~i~~-------------a~~~~~~~~~~~~~~PSq~RYv~Y~~~   55 (192)
                      +..++ .-|.|||++|.|||++++++             |++.....|+.....|.|.+.++.+.+
T Consensus       170 ~~~~~~~~VlVHC~~G~sRSa~vv~ayLm~~~~~~~~~eA~~~vr~~Rp~v~~n~~q~~~l~~~~~  235 (547)
T PRK12361        170 RQVRANKSVVVHCALGRGRSVLVLAAYLLCKDPDLTVEEVLQQIKQIRKTARLNKRQLRALEKMLE  235 (547)
T ss_pred             HHHHCCCeEEEECCCCCCcHHHHHHHHHHHhccCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
Confidence            34444 68999999999999999988             555666778888889999999998764


No 14 
>PHA02747 protein tyrosine phosphatase; Provisional
Probab=96.69  E-value=0.00055  Score=60.15  Aligned_cols=41  Identities=12%  Similarity=0.102  Sum_probs=33.1

Q ss_pred             eEEEEcCCCCCceeeeecc--c---------------cccccccCCCCCcCcchhhHH
Q psy16333         10 SDLKKCHPSLPYTGVMVSS--P---------------MNRPFIDNIFPIATPPLTLYV   50 (192)
Q Consensus        10 v~vihC~~G~grtg~~i~~--a---------------~~~~~~~~~~~~~~PSq~RYv   50 (192)
                      =++|||.+|-||||+.+|.  +               ++.....|...+.++.|-.++
T Consensus       231 PIvVHCsaGvGRtGtfcaidi~i~~l~~~~~v~v~~~V~~lR~qR~~~Vqt~~QY~F~  288 (312)
T PHA02747        231 PIVVHCSDGVGKTGIFCAVDICLNQLVKRKAICLAKTAEKIREQRHAGIMNFDDYLFI  288 (312)
T ss_pred             CEEEEecCCCcchhHHHHHHHHHHHHHhcCCCCHHHHHHHHHhccccccCCHHHHHHH
Confidence            5899999999999999887  2               223345677889999999988


No 15 
>PHA02740 protein tyrosine phosphatase; Provisional
Probab=96.59  E-value=0.0007  Score=59.25  Aligned_cols=44  Identities=5%  Similarity=-0.066  Sum_probs=33.8

Q ss_pred             CeEEEEcCCCCCceeeeecc--cc---------------ccccccCCCCCcCcchhhHHHH
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS--PM---------------NRPFIDNIFPIATPPLTLYVDY   52 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~--a~---------------~~~~~~~~~~~~~PSq~RYv~Y   52 (192)
                      .=+||||.+|-||||+.+|.  ++               .+....|...+.++.|-.++..
T Consensus       222 ~PIVVHCSaGvGRTGtFcaiDi~l~~~~~~~~vdi~~~V~~lR~qR~~~Vqt~~QY~F~y~  282 (298)
T PHA02740        222 APIIIDCIDGISSSAVFCVFDICATEFDKTGMLSIANALKKVRQKKYGCMNCLDDYVFCYH  282 (298)
T ss_pred             CCEEEECCCCCchhHHHHHHHHHHHHHHhcCcccHHHHHHHHHhhCccccCCHHHHHHHHH
Confidence            35899999999999998887  22               2334467788889999887764


No 16 
>PHA02742 protein tyrosine phosphatase; Provisional
Probab=96.55  E-value=0.00076  Score=58.98  Aligned_cols=44  Identities=11%  Similarity=0.175  Sum_probs=32.5

Q ss_pred             CeEEEEcCCCCCceeeeecc--ccc---------------cccccCCCCCcCcchhhHHHH
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS--PMN---------------RPFIDNIFPIATPPLTLYVDY   52 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~--a~~---------------~~~~~~~~~~~~PSq~RYv~Y   52 (192)
                      .=++|||.+|-||||+.+|.  +++               .....|...+.++.|-.++..
T Consensus       230 ~PIvVHCsaGvGRTGtF~aid~~i~~~~~~~~v~v~~~V~~lR~qR~~~Vqt~~QY~F~y~  290 (303)
T PHA02742        230 PPILVHCSAGLDRAGAFCAIDICISKYNERAIIPLLSIVRDLRKQRHNCLSLPQQYIFCYF  290 (303)
T ss_pred             CCeEEECCCCCchhHHHHHHHHHHHHHHhcCCCCHHHHHHHHHhhcccccCCHHHHHHHHH
Confidence            36999999999999999887  222               333456677888888777653


No 17 
>PHA02746 protein tyrosine phosphatase; Provisional
Probab=96.52  E-value=0.00095  Score=58.95  Aligned_cols=44  Identities=7%  Similarity=0.073  Sum_probs=33.0

Q ss_pred             CeEEEEcCCCCCceeeeecc--cc---------------ccccccCCCCCcCcchhhHHHH
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS--PM---------------NRPFIDNIFPIATPPLTLYVDY   52 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~--a~---------------~~~~~~~~~~~~~PSq~RYv~Y   52 (192)
                      .-++|||.+|-||||+.+|.  ++               ......|...+.++.|-.++.-
T Consensus       248 ~PIvVHCsaGvGRTGtfcaid~~l~~l~~~~~vdv~~~V~~lR~qR~~~Vqt~~QY~F~y~  308 (323)
T PHA02746        248 GPIVVHCSAGIGRAGTFCAIDNALEQLEKEKEVCLGEIVLKIRKQRHSSVFLPEQYAFCYK  308 (323)
T ss_pred             CCEEEEcCCCCCcchhHHHHHHHHHHHHhcCCCCHHHHHHHHHhcccccCCCHHHHHHHHH
Confidence            46899999999999998876  22               2333456778888888777763


No 18 
>PHA02738 hypothetical protein; Provisional
Probab=96.45  E-value=0.001  Score=58.74  Aligned_cols=43  Identities=9%  Similarity=0.108  Sum_probs=33.4

Q ss_pred             eEEEEcCCCCCceeeeecc--cc---------------ccccccCCCCCcCcchhhHHHH
Q psy16333         10 SDLKKCHPSLPYTGVMVSS--PM---------------NRPFIDNIFPIATPPLTLYVDY   52 (192)
Q Consensus        10 v~vihC~~G~grtg~~i~~--a~---------------~~~~~~~~~~~~~PSq~RYv~Y   52 (192)
                      -+||||.+|-||||+.+|.  ++               ......|...+.++.|-.|+..
T Consensus       229 PIVVHCs~GiGRtGtFcaidi~i~~~~~~~~vdv~~~V~~lR~qR~~~vqt~~QY~F~y~  288 (320)
T PHA02738        229 PIVVHCNAGLGRTPCYCVVDISISRFDACATVSIPSIVSSIRNQRYYSLFIPFQYFFCYR  288 (320)
T ss_pred             CeEEEcCCCCChhhhhhHHHHHHHHHHhcCCcCHHHHHHHHHhhhhhccCCHHHHHHHHH
Confidence            5899999999999998777  22               2334467788999999888754


No 19 
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms]
Probab=96.09  E-value=0.0032  Score=54.47  Aligned_cols=22  Identities=18%  Similarity=0.406  Sum_probs=20.2

Q ss_pred             cCCeEEEEcCCCCCceeeeecc
Q psy16333          7 RSQSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         7 ~~nv~vihC~~G~grtg~~i~~   28 (192)
                      +.+.++|||.||-|||||.|+.
T Consensus       217 ~t~piiVHCSAGvGRTGTFIal  238 (302)
T COG5599         217 RTGPIIVHCSAGVGRTGTFIAL  238 (302)
T ss_pred             CCCCEEEEeccCCCCcceeeeH
Confidence            4578999999999999999998


No 20 
>KOG0792|consensus
Probab=96.06  E-value=0.002  Score=64.07  Aligned_cols=42  Identities=17%  Similarity=0.183  Sum_probs=32.2

Q ss_pred             eEEEEcCCCCCceeeeecc--cc---------------ccccccCCCCCcCcchhhHHH
Q psy16333         10 SDLKKCHPSLPYTGVMVSS--PM---------------NRPFIDNIFPIATPPLTLYVD   51 (192)
Q Consensus        10 v~vihC~~G~grtg~~i~~--a~---------------~~~~~~~~~~~~~PSq~RYv~   51 (192)
                      =++|||.||-|||||+|+.  ||               +.....|..-|.+++|-++|.
T Consensus      1065 PilvHCSAGiGRTGVlIl~e~~l~lle~Ne~vdi~divr~mR~QR~~mVQT~~QYkFVy 1123 (1144)
T KOG0792|consen 1065 PILVHCSAGIGRTGVLILMETALCLLEHNEPVDILDIVRTMRDQRAMMVQTLSQYKFVY 1123 (1144)
T ss_pred             CeEEEccCCCCcceehHHHHHHHHHHhcCCCCCHHHHHHHHHHHHhhhccchHHhhHHH
Confidence            6899999999999999998  11               122334556788999988875


No 21 
>KOG0790|consensus
Probab=95.81  E-value=0.0044  Score=57.01  Aligned_cols=45  Identities=9%  Similarity=0.053  Sum_probs=35.9

Q ss_pred             CeEEEEcCCCCCceeeeecc--------------------ccccccccCCCCCcCcchhhHHHHH
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS--------------------PMNRPFIDNIFPIATPPLTLYVDYF   53 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~--------------------a~~~~~~~~~~~~~~PSq~RYv~Y~   53 (192)
                      .-++|||.||-||||++|-.                    .++++.+.|.+-|.+-.|-++|.|-
T Consensus       452 gpIvVHCSAGIGrTGTfiViD~lld~I~~~Gldc~iDi~ktIqmVRsqRSGmVQTEaQYkFiY~A  516 (600)
T KOG0790|consen  452 GPIVVHCSAGIGRTGTFIVIDMLLDQIREKGLDCDIDIQKTIQMVRSQRSGMVQTEAQYKFIYVA  516 (600)
T ss_pred             CcEEEEccCCcCCcceEEEhHHHHHHHHhcCCCCcccHHHHHHHHHHHhcchhhhHHhHHHHHHH
Confidence            57899999999999998877                    3345556677778888899988643


No 22 
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active.
Probab=95.79  E-value=0.0038  Score=51.67  Aligned_cols=26  Identities=19%  Similarity=0.330  Sum_probs=21.5

Q ss_pred             CCeEEEEcCCCCCceeeeecc--ccccc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS--PMNRP   33 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~--a~~~~   33 (192)
                      .+-++|||.+|.||||+++++  +++.+
T Consensus       166 ~~pivVHC~~G~gRsg~~~a~~~~~~~~  193 (231)
T cd00047         166 SGPIVVHCSAGVGRTGTFIAIDILLQRL  193 (231)
T ss_pred             CCCeEEECCCCCCccchHHHHHHHHHHH
Confidence            468999999999999999887  44444


No 23 
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain.
Probab=95.75  E-value=0.0042  Score=52.38  Aligned_cols=28  Identities=11%  Similarity=0.204  Sum_probs=22.4

Q ss_pred             CCeEEEEcCCCCCceeeeecc--ccccccc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS--PMNRPFI   35 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~--a~~~~~~   35 (192)
                      ++-++|||.+|.||||+++++  +++++..
T Consensus       193 ~~pivVHC~~G~gRsg~f~a~~~~~~~l~~  222 (258)
T smart00194      193 TGPIVVHCSAGVGRTGTFIAIDILLQQLEA  222 (258)
T ss_pred             CCCEEEEeCCCCCccchhhHHHHHHHHHHH
Confidence            357999999999999999888  4454443


No 24 
>KOG0789|consensus
Probab=95.51  E-value=0.0046  Score=55.26  Aligned_cols=45  Identities=11%  Similarity=0.079  Sum_probs=33.1

Q ss_pred             CeEEEEcCCCCCceeeeecc--ccc----------------cccccCCCCCcCcchhhHHHHH
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS--PMN----------------RPFIDNIFPIATPPLTLYVDYF   53 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~--a~~----------------~~~~~~~~~~~~PSq~RYv~Y~   53 (192)
                      .=++|||.+|.||||++++.  |+.                .....|...+.++.|-.|++-.
T Consensus       300 ~P~vVhcsaG~gRtgt~v~~~~~~~~~~~~~~~~~~~~~~~~iR~qR~~~vqt~~Qy~f~~~~  362 (415)
T KOG0789|consen  300 EPIEVHCSAGAGRAGTLVLIEHALIELQGPEGEPPIDEILREIRYQRPGAVQSPLQYLFIYAA  362 (415)
T ss_pred             CCeEEECCCCCCccchHHHHHHHHHHHhcCCCCccHHHHHHHHHHHhhhcccchhHHHHHHHH
Confidence            57899999999999999876  111                1223466788888888887643


No 25 
>PF03162 Y_phosphatase2:  Tyrosine phosphatase family;  InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity. Consequently, maintaining an appropriate level of protein tyrosine phosphorylation is essential for many cellular functions. Tyrosine-specific protein phosphatases (PTPase; 3.1.3.48 from EC) catalyse the removal of a phosphate group attached to a tyrosine residue, using a cysteinyl-phosphate enzyme intermediate. These enzymes are key regulatory components in signal transduction pathways (such as the MAP kinase pathway) and cell cycle control, and are important in the control of cell growth, proliferation, differentiation and transformation [, ]. The PTP superfamily can be divided into four subfamilies []:   (1) pTyr-specific phosphatases (2) dual specificity phosphatases (dTyr and dSer/dThr) (3) Cdc25 phosphatases (dTyr and/or dThr) (4) LMW (low molecular weight) phosphatases   Based on their cellular localisation, PTPases are also classified as:   Receptor-like, which are transmembrane receptors that contain PTPase domains [] Non-receptor (intracellular) PTPases []   All PTPases carry the highly conserved active site motif C(X)5R (PTP signature motif), employ a common catalytic mechanism, and share a similar core structure made of a central parallel beta-sheet with flanking alpha-helices containing a beta-loop-alpha-loop that encompasses the PTP signature motif []. Functional diversity between PTPases is endowed by regulatory domains and subunits.  This entry represents protein-tyrosine phosphatases predominantly from fungi, plants and bacteria, several of which are putative enzymes. These proteins are closely related to the Y-phosphatase and DSPc families. This entry includes the PTPase SIW14 from Saccharomyces cerevisiae (Baker's yeast), which plays a role in actin filament organisation and endocytosis.; PDB: 2Q47_A 1XRI_A.
Probab=95.45  E-value=0.0037  Score=50.17  Aligned_cols=43  Identities=16%  Similarity=0.161  Sum_probs=26.3

Q ss_pred             CeEEEEcCCCCCceeeeecc-----------ccc---cccccCCCCCcCcchhhHHHHHHh
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS-----------PMN---RPFIDNIFPIATPPLTLYVDYFSG   55 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~-----------a~~---~~~~~~~~~~~~PSq~RYv~Y~~~   55 (192)
                      .=+.|||+.|+.|||++|+|           +++   +|...+    ....-.+||+.|..
T Consensus        92 ~PvLiHC~~G~~rTG~vvg~lRk~Q~W~~~~i~~Ey~~f~~~~----~~~~~~~fIe~f~~  148 (164)
T PF03162_consen   92 YPVLIHCNHGKDRTGLVVGCLRKLQGWSLSSIFDEYRRFAGPK----IRYLDEQFIELFDV  148 (164)
T ss_dssp             -SEEEE-SSSSSHHHHHHHHHHHHTTB-HHHHHHHHHHHHGGG------HHHHHHHHT---
T ss_pred             CCEEEEeCCCCcchhhHHHHHHHHcCCCHHHHHHHHHHhcCCC----CcHHHHHHHHhcCc
Confidence            57899999999999999999           222   343332    23456677777754


No 26 
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional
Probab=95.09  E-value=0.0057  Score=57.17  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=17.0

Q ss_pred             EEEEcCCCCCceeeeecc
Q psy16333         11 DLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus        11 ~vihC~~G~grtg~~i~~   28 (192)
                      .||||.||-||||++||+
T Consensus       469 PVVHCSAGVGRTGTFIAi  486 (535)
T PRK15375        469 PMIHCLGGVGRTGTMAAA  486 (535)
T ss_pred             ceEEcCCCCchHHHHHHH
Confidence            489999999999999999


No 27 
>PF00102 Y_phosphatase:  Protein-tyrosine phosphatase;  InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity. Consequently, maintaining an appropriate level of protein tyrosine phosphorylation is essential for many cellular functions. Tyrosine-specific protein phosphatases (PTPase; 3.1.3.48 from EC) catalyse the removal of a phosphate group attached to a tyrosine residue, using a cysteinyl-phosphate enzyme intermediate. These enzymes are key regulatory components in signal transduction pathways (such as the MAP kinase pathway) and cell cycle control, and are important in the control of cell growth, proliferation, differentiation and transformation [, ]. The PTP superfamily can be divided into four subfamilies []:   (1) pTyr-specific phosphatases (2) dual specificity phosphatases (dTyr and dSer/dThr) (3) Cdc25 phosphatases (dTyr and/or dThr) (4) LMW (low molecular weight) phosphatases   Based on their cellular localisation, PTPases are also classified as:   Receptor-like, which are transmembrane receptors that contain PTPase domains [] Non-receptor (intracellular) PTPases []   All PTPases carry the highly conserved active site motif C(X)5R (PTP signature motif), employ a common catalytic mechanism, and share a similar core structure made of a central parallel beta-sheet with flanking alpha-helices containing a beta-loop-alpha-loop that encompasses the PTP signature motif []. Functional diversity between PTPases is endowed by regulatory domains and subunits.  This entry repesents several receptor and non-receptor protein-tyrosine phosphatases. Structurally, all known receptor PTPases, are made up of a variable length extracellular domain, followed by a transmembrane region and a C-terminal catalytic cytoplasmic domain. Some of the receptor PTPases contain fibronectin type III (FN-III) repeats, immunoglobulin-like domains, MAM domains or carbonic anhydrase-like domains in their extracellular region. The cytoplasmic region generally contains two copies of the PTPase domain. The first seems to have enzymatic activity, while the second is inactive. The inactive domains of tandem phosphatases can be divided into two classes. Those which bind phosphorylated tyrosine residues may recruit multi-phosphorylated substrates for the adjacent active domains and are more conserved, while the other class have accumulated several variable amino acid substitutions and have a complete loss of tyrosine binding capability. The second class shows a release of evolutionary constraint for the sites around the catalytic centre, which emphasises a difference in function from the first group. There is a region of higher conservation common to both classes, suggesting a new regulatory centre []. PTPase domains consist of about 300 amino acids. There are two conserved cysteines, the second one has been shown to be absolutely required for activity. Furthermore, a number of conserved residues in its immediate vicinity have also been shown to be important.; GO: 0004725 protein tyrosine phosphatase activity, 0006470 protein dephosphorylation; PDB: 3O4T_A 3O4S_A 3O4U_A 2A3K_A 2QDP_A 2QDC_A 2QDM_A 2HVL_A 1ZC0_A 3D44_A ....
Probab=94.04  E-value=0.014  Score=47.52  Aligned_cols=28  Identities=7%  Similarity=0.127  Sum_probs=22.6

Q ss_pred             CCeEEEEcCCCCCceeeeecc--ccccccc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS--PMNRPFI   35 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~--a~~~~~~   35 (192)
                      .+-++|||.+|.||||+++++  ++++...
T Consensus       170 ~~pivVhc~~G~gRsg~f~~~~~~~~~~~~  199 (235)
T PF00102_consen  170 NGPIVVHCSDGVGRSGTFCAIDILIEQLKK  199 (235)
T ss_dssp             SSEEEEESSSSSHHHHHHHHHHHHHHHHHH
T ss_pred             ccceEeecccccccccccccchhhcccccc
Confidence            478999999999999999998  4444443


No 28 
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms]
Probab=93.87  E-value=0.017  Score=49.19  Aligned_cols=20  Identities=20%  Similarity=0.300  Sum_probs=18.7

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      .-+.+||+.||-|||+++|+
T Consensus       137 ~PvL~HC~~GkdRTGl~~al  156 (249)
T COG2365         137 GPVLIHCTAGKDRTGLVAAL  156 (249)
T ss_pred             CCEEEecCCCCcchHHHHHH
Confidence            57999999999999999998


No 29 
>KOG2836|consensus
Probab=92.60  E-value=0.034  Score=43.86  Aligned_cols=44  Identities=14%  Similarity=0.119  Sum_probs=31.3

Q ss_pred             CeEEEEcCCCCCceeeeecc-----------ccccccccCCCCCcCcchhhHHHHH
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS-----------PMNRPFIDNIFPIATPPLTLYVDYF   53 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~-----------a~~~~~~~~~~~~~~PSq~RYv~Y~   53 (192)
                      --++|||-+|.||.-+++|.           |.++...+| .|....-|..|++-+
T Consensus        98 ~cvavhcvaglgrapvlvalalie~gmkyedave~ir~kr-rga~n~kql~~leky  152 (173)
T KOG2836|consen   98 CCVAVHCVAGLGRAPVLVALALIEAGMKYEDAVEMIRQKR-RGAINSKQLLYLEKY  152 (173)
T ss_pred             CeEEEEeecccCcchHHHHHHHHHccccHHHHHHHHHHHh-hccccHHHHHHHHHh
Confidence            57899999999999999887           333333344 455566787777644


No 30 
>TIGR01244 conserved hypothetical protein TIGR01244. No member of this family is characterized. The member from Xylella fastidiosa is a longer protein with an N-terminal region described by this model, followed by a metallo-beta-lactamase family domain and an additional C-terminal region. Members scoring above the trusted cutoff are limited to the proteobacteria.
Probab=91.86  E-value=0.044  Score=42.27  Aligned_cols=19  Identities=11%  Similarity=0.165  Sum_probs=16.3

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      .-+++||+.|+ |||++.+.
T Consensus        87 ~pvL~HC~sG~-Rt~~l~al  105 (135)
T TIGR01244        87 GPVLAYCRSGT-RSSLLWGF  105 (135)
T ss_pred             CCEEEEcCCCh-HHHHHHHH
Confidence            57999999999 99997654


No 31 
>KOG1716|consensus
Probab=91.25  E-value=0.13  Score=44.54  Aligned_cols=51  Identities=12%  Similarity=0.024  Sum_probs=36.2

Q ss_pred             CeEEEEcCCCCCceeeeecc------------ccccccccCCCCCcCcchhhHHHHHHhhhcC
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIFPIATPPLTLYVDYFSGLLSA   59 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~~~~~PSq~RYv~Y~~~ll~~   59 (192)
                      ..+.|||.+|-+|+.+++.|            |++.+-.+|+.....+.=.+-+.=|+..+..
T Consensus       156 ~~vlVHC~~GvSRSat~viAYlM~~~~~~l~~A~~~vk~~R~~i~PN~gf~~QL~~~e~~l~~  218 (285)
T KOG1716|consen  156 GKVLVHCQAGVSRSATLVIAYLMKYEGLSLEDAYELVKSRRPIISPNFGFLRQLLEFEKRLSK  218 (285)
T ss_pred             CeEEEEcCCccchhHHHHHHHHHHHcCCCHHHHHHHHHHhCCccCCCHHHHHHHHHHHHhhcc
Confidence            79999999999999998888            5555555665444455555666666665544


No 32 
>KOG2283|consensus
Probab=90.61  E-value=0.14  Score=47.18  Aligned_cols=55  Identities=40%  Similarity=0.619  Sum_probs=46.4

Q ss_pred             EEEEcCCCceeEEEEeeeeeeeccccCcCccccchhchhhhccccCCCCCCCCCC
Q psy16333        138 KCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPSYKR  192 (192)
Q Consensus       138 ~~yh~~~~~~~~mF~~~~F~~~hT~fi~~~~L~~~~~K~eLD~a~kd~rfp~~~~  192 (192)
                      .++++.+++|.++..|+|+.|+.-+..++..|.+|.+|++-+...+....|||+|
T Consensus       111 vvHCk~Gkgrtg~~icA~L~~~~~~~ta~eald~~~~kR~~~~~~~~~~~PSq~R  165 (434)
T KOG2283|consen  111 VVHCKAGKGRTGVMICAYLIYSGISATAEEALDYFNEKRFDEGKSKGVTIPSQRR  165 (434)
T ss_pred             EEEccCCCcceEEEEeHHHHhhhhcCCHHHHHHHHhhhhccccccCCccCchhhH
Confidence            4455669999999999999888888889999999999995556556788999987


No 33 
>KOG4228|consensus
Probab=90.20  E-value=0.23  Score=50.17  Aligned_cols=20  Identities=15%  Similarity=0.297  Sum_probs=18.2

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      .-+||||.||-||||+.|+.
T Consensus       731 GPiVVHCSAGvGRTG~fi~i  750 (1087)
T KOG4228|consen  731 GPIVVHCSAGVGRTGCFIVI  750 (1087)
T ss_pred             CCEEEECCCCCCCcceEEEe
Confidence            35899999999999999988


No 34 
>KOG2386|consensus
Probab=90.03  E-value=0.17  Score=46.01  Aligned_cols=38  Identities=18%  Similarity=0.122  Sum_probs=29.8

Q ss_pred             HhcCCeEEEEcCCCCCceeeeecc------------ccccccccCCCCCc
Q psy16333          5 LLRSQSDLKKCHPSLPYTGVMVSS------------PMNRPFIDNIFPIA   42 (192)
Q Consensus         5 ~~~~nv~vihC~~G~grtg~~i~~------------a~~~~~~~~~~~~~   42 (192)
                      .+...++.+||..|+-|||-|||+            |+++|...|..++.
T Consensus       121 ~~~~~LI~vhcthG~NrtgyLI~~yL~~~~~~s~~~aik~f~~~r~~gi~  170 (393)
T KOG2386|consen  121 KLDDELIGVHCTHGLNRTGYLICAYLADVGGYSSSEAIKRFADARPPGIE  170 (393)
T ss_pred             cCCCCEEEEeCCCcccccceeeeeeeeeccCccHHHHHHHHHHhCCCccC
Confidence            455679999999999999999999            66667666655443


No 35 
>KOG0793|consensus
Probab=90.01  E-value=0.18  Score=48.98  Aligned_cols=19  Identities=16%  Similarity=0.226  Sum_probs=17.0

Q ss_pred             eEEEEcCCCCCceeeeecc
Q psy16333         10 SDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus        10 v~vihC~~G~grtg~~i~~   28 (192)
                      -++|||.+|.|||||-|..
T Consensus       929 pIiVH~sdGaGRTG~Yili  947 (1004)
T KOG0793|consen  929 PIIVHCSDGAGRTGTYILI  947 (1004)
T ss_pred             ceEEEccCCCCccceeeeH
Confidence            5899999999999997765


No 36 
>KOG0791|consensus
Probab=89.44  E-value=0.19  Score=45.33  Aligned_cols=20  Identities=15%  Similarity=0.406  Sum_probs=18.5

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      ...+|||.+|-|||||.||-
T Consensus       288 ~p~iVhCSAGVgRTGTFial  307 (374)
T KOG0791|consen  288 GPTIVHCSAGVGRTGTFIAL  307 (374)
T ss_pred             CceeEEeecccccccchHhH
Confidence            37899999999999999988


No 37 
>PLN02727 NAD kinase
Probab=87.12  E-value=0.19  Score=50.19  Aligned_cols=21  Identities=19%  Similarity=0.082  Sum_probs=19.5

Q ss_pred             CCeEEEEcCCCCCceeeeecc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~   28 (192)
                      ..=+.+||+.|.+|||+|+||
T Consensus       341 pkPVLvHCKSGarRAGamvA~  361 (986)
T PLN02727        341 KKPIYLHSKEGVWRTSAMVSR  361 (986)
T ss_pred             CCCEEEECCCCCchHHHHHHH
Confidence            367899999999999999999


No 38 
>KOG1572|consensus
Probab=85.86  E-value=0.29  Score=41.75  Aligned_cols=20  Identities=25%  Similarity=0.331  Sum_probs=18.9

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      .=+.|||+-||-|||++|.|
T Consensus       149 ~P~Lihc~rGkhRtg~lVgc  168 (249)
T KOG1572|consen  149 YPILIHCKRGKHRTGCLVGC  168 (249)
T ss_pred             CceEEecCCCCcchhhhHHH
Confidence            57899999999999999999


No 39 
>KOG4471|consensus
Probab=85.34  E-value=0.25  Score=47.18  Aligned_cols=22  Identities=32%  Similarity=0.363  Sum_probs=19.6

Q ss_pred             CeEEEEcCCCCCceeeeecccc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSSPM   30 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~a~   30 (192)
                      .-|+|||.+|+.||..++|.||
T Consensus       375 ~sVlVHCSDGWDRT~QlvsLA~  396 (717)
T KOG4471|consen  375 RSVLVHCSDGWDRTAQLVSLAM  396 (717)
T ss_pred             ceEEEEcCCCccchHHHHHHHH
Confidence            6899999999999999998843


No 40 
>KOG4228|consensus
Probab=72.29  E-value=2.4  Score=43.17  Aligned_cols=21  Identities=14%  Similarity=0.245  Sum_probs=18.9

Q ss_pred             CCeEEEEcCCCCCceeeeecc
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~   28 (192)
                      ..-.+|||.+|.||||+.+|+
T Consensus      1018 ~~P~~Vhc~nG~~rsg~f~ai 1038 (1087)
T KOG4228|consen 1018 DGPIIVHCLNGVGRTGTFCAI 1038 (1087)
T ss_pred             CCCEEEEEcCCCcceeehHHH
Confidence            356899999999999999988


No 41 
>PF06602 Myotub-related:  Myotubularin-like phosphatase domain;  InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO. Myotubularin is a dual-specific lipid phosphatase that dephosphorylates phosphatidylinositol 3-phosphate and phosphatidylinositol (3,5)-bi-phosphate []. Mutations in gene encoding myotubularin-related proteins have been associated with disease [].; GO: 0016791 phosphatase activity, 0016311 dephosphorylation; PDB: 1M7R_B 1LW3_A 1ZVR_A 1ZSQ_A 2YF0_A.
Probab=71.52  E-value=1.8  Score=38.83  Aligned_cols=27  Identities=26%  Similarity=0.334  Sum_probs=19.8

Q ss_pred             hhhHh--cCCeEEEEcCCCCCceeeeecc
Q psy16333          2 VLELL--RSQSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         2 ~~~~~--~~nv~vihC~~G~grtg~~i~~   28 (192)
                      +.++|  .+..|+|||.+|+.||..+.|.
T Consensus       223 i~~~l~~~~~~Vlvh~~dGwDrt~q~~sL  251 (353)
T PF06602_consen  223 IADLLHDEGSSVLVHCSDGWDRTSQLSSL  251 (353)
T ss_dssp             HHHHHHTT--EEEEECTTSSSHHHHHHHH
T ss_pred             HHHHhhccCceEEEEcCCCCcccHHHHHH
Confidence            34555  3379999999999999887665


No 42 
>KOG1717|consensus
Probab=62.11  E-value=3.4  Score=36.22  Aligned_cols=27  Identities=11%  Similarity=0.111  Sum_probs=21.9

Q ss_pred             hhhHhcC-CeEEEEcCCCCCceeeeecc
Q psy16333          2 VLELLRS-QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         2 ~~~~~~~-nv~vihC~~G~grtg~~i~~   28 (192)
                      |.+..++ --|.|||.+|-.|+.|+..+
T Consensus       244 IdeArsk~cgvLVHClaGISRSvTvtva  271 (343)
T KOG1717|consen  244 IDEARSKNCGVLVHCLAGISRSVTVTVA  271 (343)
T ss_pred             HHHhhccCCcEEEeeeccccchhHHHHH
Confidence            3455556 47899999999999998888


No 43 
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4. Rasal1 and RasA4 are both members of GAP1 (GTPase activating protein 1).  Rasal1 responds to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras. RasA4 suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  Both of these proteins contains two C2 domains, a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  
Probab=57.63  E-value=27  Score=25.71  Aligned_cols=38  Identities=16%  Similarity=0.215  Sum_probs=27.2

Q ss_pred             eEEEEEEEecCCCCCCCCCceeEEEEEEecceeEeeccc
Q psy16333         68 LYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGV  106 (192)
Q Consensus        68 l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~  106 (192)
                      |+++=+.-.++|..+.. |.|.||++|+.+.+.++.|..
T Consensus         2 l~v~vi~a~~L~~~d~~-g~~DPYv~v~~~~~~~~kT~v   39 (121)
T cd04054           2 LYIRIVEGKNLPAKDIT-GSSDPYCIVKVDNEVIIRTAT   39 (121)
T ss_pred             EEEEEEEeeCCcCCCCC-CCCCceEEEEECCEeeeeeee
Confidence            45555566677777764 789999999987766666544


No 44 
>KOG1718|consensus
Probab=54.90  E-value=4.5  Score=33.16  Aligned_cols=23  Identities=13%  Similarity=0.339  Sum_probs=19.4

Q ss_pred             hcCCeEEEEcCCCCCceeeeecc
Q psy16333          6 LRSQSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         6 ~~~nv~vihC~~G~grtg~~i~~   28 (192)
                      +++.-..|||.||-.|++.++-+
T Consensus        92 ~~gG~TLvHC~AGVSRSAsLClA  114 (198)
T KOG1718|consen   92 MRGGKTLVHCVAGVSRSASLCLA  114 (198)
T ss_pred             hcCCcEEEEEccccchhHHHHHH
Confidence            35588999999999999987666


No 45 
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike Slp3 and Slp4/granuphilin which are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain.  In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety 
Probab=53.18  E-value=25  Score=26.13  Aligned_cols=31  Identities=13%  Similarity=0.141  Sum_probs=24.9

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++-|.-..+|..+...|.|.||++|+-
T Consensus        15 ~~L~V~vi~a~~L~~~d~~~g~~dpyVkv~l   45 (125)
T cd08393          15 RELHVHVIQCQDLAAADPKKQRSDPYVKTYL   45 (125)
T ss_pred             CEEEEEEEEeCCCCCcCCCCCCCCcEEEEEE
Confidence            4577788888889988763378999999986


No 46 
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3. RasA2 and RasA3 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  RasA2 and RasA3 are both inositol 1,3,4,5-tetrakisphosphate-binding proteins and contain an N-terminal C2 domain, a Ras-GAP domain, a pleckstrin-homology (PH) domain which localizes it to the plasma membrane, and Bruton's Tyrosine Kinase (BTK) a zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular p
Probab=52.08  E-value=32  Score=25.50  Aligned_cols=39  Identities=8%  Similarity=-0.023  Sum_probs=25.6

Q ss_pred             eEEEEEEEecCCCCCCCCCceeEEEEEEecceeEeeccc
Q psy16333         68 LYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGV  106 (192)
Q Consensus        68 l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~  106 (192)
                      |.+.-+.-.++|..+...|.|.||++|+-+.+.++.|..
T Consensus         2 l~v~v~~a~~L~~~~~~~g~sDpYv~v~l~~~~~~kT~v   40 (121)
T cd08401           2 LKIKIGEAKNLPPRSGPNKMRDCYCTVNLDQEEVFRTKT   40 (121)
T ss_pred             eEEEEEEccCCCCCCCCCCCcCcEEEEEECCccEEEeeE
Confidence            344445555677764323679999999887766676654


No 47 
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protein
Probab=50.24  E-value=41  Score=24.48  Aligned_cols=68  Identities=18%  Similarity=0.172  Sum_probs=39.6

Q ss_pred             eEEEEEEEecCCCCCCCCCceeEEEEEEecceeEeecccccc--CCCcc-eeEEEEeccccccCceEecCeEEEEEEcCC
Q psy16333         68 LYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGV--GSEAR-QFTVNVAGERQRRGLQLRGDILLKCYHRGN  144 (192)
Q Consensus        68 l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~~~~--~~~~~-~~~~~~~~~~~~~~~~l~GDI~V~~yh~~~  144 (192)
                      |.++=+.-.++|..+.. +.|.||++|+-+.+.++.|....-  .+.-. .+... +.     .  ....+.+++|+...
T Consensus         2 L~v~v~~a~~L~~~d~~-g~~Dpyv~v~~~~~~~~kT~~~~~t~nP~Wne~f~f~-v~-----~--~~~~l~~~v~D~d~   72 (121)
T cd04042           2 LDIHLKEGRNLAARDRG-GTSDPYVKFKYGGKTVYKSKTIYKNLNPVWDEKFTLP-IE-----D--VTQPLYIKVFDYDR   72 (121)
T ss_pred             eEEEEEEeeCCCCcCCC-CCCCCeEEEEECCEEEEEeeeccCCCCCccceeEEEE-ec-----C--CCCeEEEEEEeCCC
Confidence            34444455567877763 789999999988777777654221  11111 12111 11     1  24568899998873


No 48 
>KOG1089|consensus
Probab=44.84  E-value=8.6  Score=36.80  Aligned_cols=26  Identities=27%  Similarity=0.181  Sum_probs=20.7

Q ss_pred             hhHhcC--CeEEEEcCCCCCceeeeecc
Q psy16333          3 LELLRS--QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         3 ~~~~~~--nv~vihC~~G~grtg~~i~~   28 (192)
                      .+.|..  --|+|||.+|+.||..+.|.
T Consensus       337 a~~l~~~~~sVlvhcsdGwDrT~qV~SL  364 (573)
T KOG1089|consen  337 AKCLSSEGASVLVHCSDGWDRTCQVSSL  364 (573)
T ss_pred             HHHHHhCCCeEEEEccCCcchhHHHHHH
Confidence            344553  47999999999999988777


No 49 
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins. A single C2 domain is found in Smurf proteins, C2-WW-HECT-domain E3s, which play an important role in the downregulation of the TGF-beta signaling pathway.  Smurf proteins also regulate cell shape, motility, and polarity by degrading small guanosine triphosphatases (GTPases). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are 
Probab=43.29  E-value=1.3e+02  Score=22.01  Aligned_cols=37  Identities=19%  Similarity=-0.041  Sum_probs=24.2

Q ss_pred             EEEEEEEecCCCCCCCCCceeEEEEEEecceeEeeccc
Q psy16333         69 YLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGV  106 (192)
Q Consensus        69 ~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~  106 (192)
                      .++-+.-.++|..+.. +.+.||++|+-+...++.|..
T Consensus         3 ~v~v~~A~~L~~~~~~-~~~dpyv~v~~~~~~~~kT~v   39 (123)
T cd08382           3 RLTVLCADGLAKRDLF-RLPDPFAVITVDGGQTHSTDV   39 (123)
T ss_pred             EEEEEEecCCCccCCC-CCCCcEEEEEECCccceEccE
Confidence            3444444567766653 679999999986555666654


No 50 
>PF00168 C2:  C2 domain;  InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking. C2 domains are unique among membrane targeting domains in that they show wide range of lipid selectivity for the major components of cell membranes, including phosphatidylserine and phosphatidylcholine. This C2 domain is about 116 amino-acid residues and is located between the two copies of the C1 domain in Protein Kinase C (that bind phorbol esters and diacylglycerol) (see PDOC00379 from PROSITEDOC) and the protein kinase catalytic domain (see PDOC00100 from PROSITEDOC). Regions with significant homology [] to the C2-domain have been found in many proteins. The C2 domain is thought to be involved in calcium-dependent phospholipid binding [] and in membrane targetting processes such as subcellular localisation. The 3D structure of the C2 domain of synaptotagmin has been reported [], the domain forms an eight-stranded beta sandwich constructed around a conserved 4-stranded motif, designated a C2 key []. Calcium binds in a cup-shaped depression formed by the N- and C-terminal loops of the C2-key motif. Structural analyses of several C2 domains have shown them to consist of similar ternary structures in which three Ca2+-binding loops are located at the end of an 8 stranded antiparallel beta sandwich. ; GO: 0005515 protein binding; PDB: 1RSY_A 1BYN_A 3NSJ_A 3QR1_D 3HN8_C 1DQV_A 3M7F_B 3KWU_A 3KWT_A 1V27_A ....
Probab=40.83  E-value=99  Score=19.95  Aligned_cols=72  Identities=10%  Similarity=0.018  Sum_probs=38.7

Q ss_pred             EEEEEEEecCCCCCCCCCceeEEEEEEeccee--EeeccccccCCCcceeE-EEEeccccccCceEecCeEEEEEEcCCC
Q psy16333         69 YLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVC--VYTSGVHGVGSEARQFT-VNVAGERQRRGLQLRGDILLKCYHRGNK  145 (192)
Q Consensus        69 ~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~--v~tS~~~~~~~~~~~~~-~~~~~~~~~~~~~l~GDI~V~~yh~~~~  145 (192)
                      .++=+...++|..+.. +...||++|+-+...  .+.|....-. ....+. ...+..    ...-..+|.|++|+.+..
T Consensus         2 ~v~I~~a~~L~~~~~~-~~~~~yv~v~~~~~~~~~~~T~~~~~~-~~P~w~e~~~~~~----~~~~~~~l~~~V~~~~~~   75 (85)
T PF00168_consen    2 TVTIHSARNLPSKDSN-GKPDPYVRVSVNGSESTKYKTKVKKNT-SNPVWNEEFEFPL----DDPDLDSLSFEVWDKDSF   75 (85)
T ss_dssp             EEEEEEEESSSSSSTT-SSBEEEEEEEEETTTCEEEEECCBSSB-SSEEEEEEEEEEE----SHGCGTEEEEEEEEETSS
T ss_pred             EEEEEEEECCCCcccC-Ccccccceeecceeeeeeeeeeeeecc-ccceeeeeeeeee----ecccccceEEEEEECCCC
Confidence            3444566777876663 678999999976532  3544432111 111111 111110    122334499999999844


Q ss_pred             c
Q psy16333        146 D  146 (192)
Q Consensus       146 ~  146 (192)
                      +
T Consensus        76 ~   76 (85)
T PF00168_consen   76 G   76 (85)
T ss_dssp             S
T ss_pred             C
Confidence            4


No 51 
>cd04041 C2A_fungal C2 domain first repeat; fungal group. C2 domains were first identified in Protein Kinase C (PKC). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligan
Probab=40.07  E-value=1.4e+02  Score=21.39  Aligned_cols=39  Identities=15%  Similarity=0.160  Sum_probs=23.7

Q ss_pred             eEEEEEEEecCCCCCCCCCceeEEEEEEec--ceeEeeccc
Q psy16333         68 LYLTHVTVLGAPSFDRCGGGCHAFLKIYEG--LVCVYTSGV  106 (192)
Q Consensus        68 l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~--~~~v~tS~~  106 (192)
                      |.++=+.-.++|..+...+.|.||++|+-.  .+.++.|..
T Consensus         3 L~V~v~~a~~L~~~d~~~~~~Dpyv~v~~~~~~~~~~kT~v   43 (111)
T cd04041           3 LVVTIHRATDLPKADFGTGSSDPYVTASFAKFGKPLYSTRI   43 (111)
T ss_pred             EEEEEEEeeCCCcccCCCCCCCccEEEEEccCCCccEeeee
Confidence            344445556777766622679999999853  234455543


No 52 
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family. This CD contains members of the regulator of G-protein signaling (RGS) family. RGS is a GTPase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. There are multiple alternatively spliced transcript variants in this family with some members having additional domains (ex. PDZ and RGS) downstream of the C2 domain. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind pho
Probab=38.71  E-value=53  Score=24.27  Aligned_cols=32  Identities=25%  Similarity=0.419  Sum_probs=24.8

Q ss_pred             CCCCeEEEEEEEecCCCCCCCCCceeEEEEEEec
Q psy16333         64 NSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG   97 (192)
Q Consensus        64 ~~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~   97 (192)
                      ....|.++=|.-..+|..+  .+.|.||++|+-.
T Consensus        10 ~~~~L~V~Vi~ar~L~~~~--~g~~dpYVkv~l~   41 (119)
T cd08685          10 QNRKLTLHVLEAKGLRSTN--SGTCNSYVKISLS   41 (119)
T ss_pred             cCCEEEEEEEEEECCCCCC--CCCCCeeEEEEEE
Confidence            4456777778888888876  3789999999953


No 53 
>PRK15378 inositol phosphate phosphatase SopB; Provisional
Probab=37.63  E-value=21  Score=33.80  Aligned_cols=20  Identities=25%  Similarity=0.285  Sum_probs=17.7

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      .|-+..||.||.|||+|=+.
T Consensus       457 avP~wNCkSGKDRTGmmD~e  476 (564)
T PRK15378        457 AVPAWNCKSGKDRTGMMDSE  476 (564)
T ss_pred             ceeeeccCCCCccccchHHH
Confidence            67788999999999998776


No 54 
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone. The members of this CD are named after the Human KIAA0528 cDNA clone.  All members here contain a single C2 repeat.  No other information on this protein is currently known. The C2 domain was first identified in PKC.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/a
Probab=36.86  E-value=85  Score=22.49  Aligned_cols=35  Identities=23%  Similarity=0.359  Sum_probs=23.1

Q ss_pred             EEEEEEecCCCCCCCCCceeEEEEEEecceeEeecc
Q psy16333         70 LTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSG  105 (192)
Q Consensus        70 L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~  105 (192)
                      ++=+.-.++|..+...+.+.||++|+-+.+ .+.|.
T Consensus         3 V~v~~a~~L~~~d~~~~~~Dpyv~v~~~~~-~~kT~   37 (110)
T cd08688           3 VRVVAARDLPVMDRSSDLTDAFVEVKFGST-TYKTD   37 (110)
T ss_pred             EEEEEEECCCccccCCCCCCceEEEEECCe-eEecc
Confidence            344455677877753467999999998763 34443


No 55 
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only]
Probab=36.72  E-value=18  Score=29.17  Aligned_cols=19  Identities=16%  Similarity=0.167  Sum_probs=14.9

Q ss_pred             HhcCCeEEEEcCCCCCcee
Q psy16333          5 LLRSQSDLKKCHPSLPYTG   23 (192)
Q Consensus         5 ~~~~nv~vihC~~G~grtg   23 (192)
                      |-+..=.+|||.+|-+||-
T Consensus        90 wp~~apllIHC~aGISRSt  108 (172)
T COG5350          90 WPRFAPLLIHCYAGISRST  108 (172)
T ss_pred             Cccccceeeeeccccccch
Confidence            3444678999999999975


No 56 
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  
Probab=36.41  E-value=84  Score=23.12  Aligned_cols=36  Identities=6%  Similarity=0.036  Sum_probs=24.3

Q ss_pred             EEEEEEecCCCCCCCCCceeEEEEEEecceeEeeccc
Q psy16333         70 LTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGV  106 (192)
Q Consensus        70 L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~  106 (192)
                      +.-+.-..+|..+. .+.|.||++|+-+.+.+++|..
T Consensus         5 V~Vi~a~~L~~~d~-~g~~DPYv~v~~~~~~~~kT~~   40 (120)
T cd04045           5 LHIRKANDLKNLEG-VGKIDPYVRVLVNGIVKGRTVT   40 (120)
T ss_pred             EEEEeeECCCCccC-CCCcCCEEEEEECCEEeeceeE
Confidence            33344446677665 3679999999987666666654


No 57 
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. 
Probab=34.25  E-value=75  Score=22.64  Aligned_cols=33  Identities=27%  Similarity=0.435  Sum_probs=23.0

Q ss_pred             EEEecCCCCCCCCCceeEEEEEEecceeEeeccc
Q psy16333         73 VTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGV  106 (192)
Q Consensus        73 I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~  106 (192)
                      +.-..+|..+. .+.+.||++|+-+.+.+++|..
T Consensus         6 i~a~~L~~~~~-~~~~dpyv~v~~~~~~~~~T~v   38 (115)
T cd04040           6 ISAENLPSADR-NGKSDPFVKFYLNGEKVFKTKT   38 (115)
T ss_pred             EeeeCCCCCCC-CCCCCCeEEEEECCCcceeece
Confidence            34445677665 3678999999987666666654


No 58 
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involv
Probab=34.09  E-value=1.8e+02  Score=21.01  Aligned_cols=40  Identities=13%  Similarity=0.076  Sum_probs=27.3

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe--cceeEeeccc
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE--GLVCVYTSGV  106 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~--~~~~v~tS~~  106 (192)
                      ..|.++=+.-.++|..+. .+.|.||++|+-  +...++.|..
T Consensus        16 ~~L~V~v~~a~~L~~~d~-~g~~dpyv~v~l~~~~~~~~kT~v   57 (124)
T cd08387          16 GILNVKLIQARNLQPRDF-SGTADPYCKVRLLPDRSNTKQSKI   57 (124)
T ss_pred             CEEEEEEEEeeCCCCCCC-CCCCCCeEEEEEecCCCCcEeCce
Confidence            346677777778888776 377999999996  3334454443


No 59 
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. Little is known about the expression or localization of Slp3.  The C2A domain of Slp3 is Ca2+ dependent.  It has been demonstrated that Slp3 promotes dense-core vesicle exocytosis.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids
Probab=33.91  E-value=76  Score=23.83  Aligned_cols=31  Identities=19%  Similarity=0.198  Sum_probs=23.7

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++=+....+|..+...|.|.||++++-
T Consensus        15 ~~L~V~V~~a~nL~~~d~~~g~~dpYVkv~l   45 (128)
T cd08392          15 SCLEITIKACRNLAYGDEKKKKCHPYVKVCL   45 (128)
T ss_pred             CEEEEEEEecCCCCccCCCCCCCCeEEEEEE
Confidence            4577777778888877653378999999985


No 60 
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 12, a member of class 6 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmins 8 and 13, do not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycl
Probab=33.37  E-value=85  Score=23.92  Aligned_cols=31  Identities=16%  Similarity=0.134  Sum_probs=24.6

Q ss_pred             CCCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         65 SAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        65 ~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ...|.++-|.-..+|..+. .|.|.||++|+-
T Consensus        14 ~~~L~V~Vi~A~nL~~~~~-~g~~DpyVkv~l   44 (136)
T cd08406          14 AERLTVVVVKARNLVWDNG-KTTADPFVKVYL   44 (136)
T ss_pred             CCEEEEEEEEeeCCCCccC-CCCCCeEEEEEE
Confidence            3457777888888988776 478999999985


No 61 
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs). RasGAPs suppress Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  The proteins here all contain either a single C2 domain or two tandem C2 domains,  a Ras-GAP domain, and a pleckstrin homology (PH)-like domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 
Probab=32.84  E-value=98  Score=21.98  Aligned_cols=33  Identities=18%  Similarity=0.137  Sum_probs=22.0

Q ss_pred             EEEEEEecCCCCCCCCCceeEEEEEEecceeEeeccc
Q psy16333         70 LTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGV  106 (192)
Q Consensus        70 L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~  106 (192)
                      ++-+.=.++|..    +.|.||++|+-+.+.++.|..
T Consensus         4 v~vi~a~~l~~~----~~~dpyv~v~~~~~~~~kT~~   36 (117)
T cd08383           4 LRILEAKNLPSK----GTRDPYCTVSLDQVEVARTKT   36 (117)
T ss_pred             EEEEEecCCCcC----CCCCceEEEEECCEEeEecce
Confidence            333334455543    579999999988777776654


No 62 
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins. KIAA proteins are uncharacterized human proteins. They were compiled by the Kazusa mammalian cDNA project which identified more than 2000 human genes. They are identified by 4 digit codes that precede the KIAA designation.  Many KIAA genes are still functionally uncharacterized including KIAA1228. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1
Probab=32.22  E-value=85  Score=22.79  Aligned_cols=31  Identities=16%  Similarity=0.197  Sum_probs=25.2

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEec
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG   97 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~   97 (192)
                      ..|.++-+.-.++|..+. .+.|.||++|+-.
T Consensus        16 ~~L~V~vi~a~~L~~~~~-~~~~dpyv~v~l~   46 (127)
T cd04030          16 QKLIVTVHKCRNLPPCDS-SDIPDPYVRLYLL   46 (127)
T ss_pred             CEEEEEEEEEECCCCccC-CCCCCceEEEEEE
Confidence            557777788889998887 3789999999953


No 63 
>cd04048 C2A_Copine C2 domain first repeat in Copine. There are 2 copies of the C2 domain present in copine, a protein involved in membrane trafficking, protein-protein interactions, and perhaps even cell division and growth.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 doma
Probab=31.70  E-value=2e+02  Score=20.75  Aligned_cols=27  Identities=11%  Similarity=0.101  Sum_probs=19.5

Q ss_pred             EEEEecCCCCCCCCCceeEEEEEEecce
Q psy16333         72 HVTVLGAPSFDRCGGGCHAFLKIYEGLV   99 (192)
Q Consensus        72 ~I~l~~iP~f~~~~~gC~p~i~I~~~~~   99 (192)
                      +|.-..+|..+.. +.|.||++|+-...
T Consensus         6 ~i~a~~L~~~d~~-g~~DPyv~v~~~~~   32 (120)
T cd04048           6 SISCRNLLDKDVL-SKSDPFVVVYVKTG   32 (120)
T ss_pred             EEEccCCCCCCCC-CCCCcEEEEEEEcC
Confidence            4556667777763 67999999997543


No 64 
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmin 4, a member of class 4 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmin-11, has an Asp to Ser substitution in its C2A domain. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling s
Probab=30.53  E-value=1e+02  Score=22.95  Aligned_cols=31  Identities=16%  Similarity=0.259  Sum_probs=24.2

Q ss_pred             CCCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         65 SAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        65 ~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ...|.++-+.-..+|..+.. +.|.||++|+-
T Consensus        14 ~~~L~V~vi~a~~L~~~d~~-g~~Dpyv~v~l   44 (136)
T cd08404          14 TNRLTVVVLKARHLPKMDVS-GLADPYVKVNL   44 (136)
T ss_pred             CCeEEEEEEEeeCCCccccC-CCCCeEEEEEE
Confidence            34577777778888888774 78999999985


No 65 
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain.  Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence 
Probab=30.29  E-value=1e+02  Score=22.89  Aligned_cols=32  Identities=16%  Similarity=0.334  Sum_probs=24.2

Q ss_pred             CCCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         65 SAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        65 ~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ...|.++=+.-.++|..+...+.|.||++|+-
T Consensus        15 ~~~L~V~Vi~a~~L~~~~~~~~~~DpyV~v~l   46 (128)
T cd08388          15 KKALLVNIIECRDLPAMDEQSGTSDPYVKLQL   46 (128)
T ss_pred             CCEEEEEEEEeECCCCCCCCCCCcCCEEEEEE
Confidence            34577777788889988763367999999864


No 66 
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=30.21  E-value=93  Score=22.55  Aligned_cols=30  Identities=30%  Similarity=0.460  Sum_probs=23.1

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++-+.-.++|..+.. +.|.||++|+-
T Consensus        16 ~~L~v~v~~a~~L~~~d~~-~~~dpyv~v~~   45 (125)
T cd08386          16 STLTLKILKAVELPAKDFS-GTSDPFVKIYL   45 (125)
T ss_pred             CEEEEEEEEecCCCCccCC-CCCCceEEEEE
Confidence            4566777777788887763 67999999986


No 67 
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks). There are 3 classes of PI3Ks based on structure, regulation, and specificity.  All classes contain a N-terminal C2 domain, a PIK domain, and a kinase catalytic domain. Unlike class I and class III, class II PI3Ks have additionally a PX domain and a C-terminal C2 domain containing a nuclear localization signal both of which bind phospholipids though in a slightly different fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility. PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permut
Probab=29.86  E-value=73  Score=23.55  Aligned_cols=34  Identities=15%  Similarity=0.262  Sum_probs=25.9

Q ss_pred             cCCCCCeEEEEEEEecCCCCCCCCCceeEEEEEEec
Q psy16333         62 RINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG   97 (192)
Q Consensus        62 ~~~~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~   97 (192)
                      .++...|.++=|.-..+|..+ . +.|.||++|+-.
T Consensus         9 ~y~~~~L~V~Vi~A~~L~~~~-~-~~~DpyVkv~l~   42 (122)
T cd08381           9 SYKNGTLFVMVMHAKNLPLLD-G-SDPDPYVKTYLL   42 (122)
T ss_pred             EEeCCEEEEEEEEeeCCCCCC-C-CCCCCEEEEEEe
Confidence            344556777778888888887 3 789999999864


No 68 
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane.  They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus.  Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and
Probab=29.15  E-value=1e+02  Score=22.37  Aligned_cols=41  Identities=22%  Similarity=0.357  Sum_probs=28.0

Q ss_pred             CCCeEEEEEEEecCCCCCCCCCceeEEEEEEec--ceeEeeccc
Q psy16333         65 SAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG--LVCVYTSGV  106 (192)
Q Consensus        65 ~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~--~~~v~tS~~  106 (192)
                      ...|.++=+.-.++|..+. .+.|.||++|+-.  ....+.|..
T Consensus        15 ~~~L~V~v~~a~~L~~~d~-~~~~dpyv~v~l~~~~~~~~kT~v   57 (124)
T cd08385          15 SNQLTVGIIQAADLPAMDM-GGTSDPYVKVYLLPDKKKKFETKV   57 (124)
T ss_pred             CCEEEEEEEEeeCCCCccC-CCCCCCEEEEEEEcCCCCceeccc
Confidence            3457777778888887776 3679999999853  233444443


No 69 
>PF05925 IpgD:  Enterobacterial virulence protein IpgD;  InterPro: IPR008108 Some Gram-negative animal enteropathogens express a specialised secretion system to directly "inject" exotoxins into the cytoplasm of host cells. Dubbed the type III secretion system, it is of specific interest to researchers, as the components of such a system are only expressed in pathogenic strains []. The system is composed of structural proteins and exotoxin effectors; these are often encoded on large virulence plasmids or on the bacterial chromosome itself [].  The Shigella flexneri invasion plasmid antigen (ipa) genes are found on such a plasmid, and are arranged into an operon. Directly upstream of this operon is another cluster of type III genes, termed ipgD, E and F []. Deletion mutational studies of all three genes showed they were essential for virulence in S. flexneri, and that IpgD is secreted by the type III needle to the outside of the bacterial cell []. Further analysis of the ipg operon confirmed that the IpgD gene product is chaperoned by the IpgE protein while in the bacterial cytoplasm [].  More recently, a large study into the spread of the ipa/mxi/ipg pathogenicity islands through their relevant plasmid has revealed that homologues exist in many different Shigella strains, as well as enteroinvasive Escherichia coli and Salmonella spp []. There is evidence that the genes were acquired from Shigella through lateral transfer, like most of the other type III secretion system virulence plasmids.; GO: 0016791 phosphatase activity, 0009405 pathogenesis; PDB: 4DID_B.
Probab=28.94  E-value=19  Score=34.33  Aligned_cols=20  Identities=15%  Similarity=0.237  Sum_probs=0.0

Q ss_pred             CeEEEEcCCCCCceeeeecc
Q psy16333          9 QSDLKKCHPSLPYTGVMVSS   28 (192)
Q Consensus         9 nv~vihC~~G~grtg~~i~~   28 (192)
                      -+...-||.||.|||+|-+.
T Consensus       454 avp~~NCKSGKDRTG~lD~e  473 (559)
T PF05925_consen  454 AVPCWNCKSGKDRTGMLDAE  473 (559)
T ss_dssp             --------------------
T ss_pred             CeeeccCccCCccccccHHH
Confidence            56778899999999998776


No 70 
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domai
Probab=28.64  E-value=1e+02  Score=22.65  Aligned_cols=31  Identities=19%  Similarity=0.343  Sum_probs=24.2

Q ss_pred             CCCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         65 SAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        65 ~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ...|.++=+.-.++|..+.. +.|.||++|+-
T Consensus        12 ~~~L~V~Vi~a~~L~~~d~~-~~~DpyV~v~l   42 (133)
T cd08384          12 RRGLIVGIIRCVNLAAMDAN-GYSDPFVKLYL   42 (133)
T ss_pred             CCEEEEEEEEEcCCCCcCCC-CCCCcEEEEEE
Confidence            34577777777888988773 78999999985


No 71 
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp4/granuphilin promotes dense-core vesicle exocytosis. The C2A domain of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2
Probab=27.98  E-value=1.2e+02  Score=22.49  Aligned_cols=32  Identities=13%  Similarity=0.052  Sum_probs=23.4

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEec
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG   97 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~   97 (192)
                      ..|.++=+.-.++|..+...+.|.||++|+-.
T Consensus        15 ~~L~V~Vi~a~~L~~~~~~~~~~DpyVkv~l~   46 (125)
T cd04029          15 QSLNVHVKECRNLAYGDEAKKRSNPYVKTYLL   46 (125)
T ss_pred             CeEEEEEEEecCCCccCCCCCCCCcEEEEEEE
Confidence            44667777778888766534679999999863


No 72 
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4. RasA1 and RasA4 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  Both proteins contain two C2 domains,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such a
Probab=26.60  E-value=1.7e+02  Score=21.20  Aligned_cols=32  Identities=16%  Similarity=0.225  Sum_probs=21.4

Q ss_pred             eEEEEEEEecCCCCCCCCCceeEEEEEEeccee
Q psy16333         68 LYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVC  100 (192)
Q Consensus        68 l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~  100 (192)
                      |.++-+.-..+|..+. .+.|.||++|+.+.+.
T Consensus         2 L~v~vi~a~~L~~~d~-~~~~DPyv~v~~~~~~   33 (123)
T cd04025           2 LRCHVLEARDLAPKDR-NGTSDPFVRVFYNGQT   33 (123)
T ss_pred             EEEEEEEeeCCCCCCC-CCCcCceEEEEECCEE
Confidence            3444455556676665 3679999999986544


No 73 
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=26.39  E-value=1.6e+02  Score=21.51  Aligned_cols=33  Identities=15%  Similarity=0.043  Sum_probs=22.3

Q ss_pred             eEEEEEEEecCCCCCCCCCceeEEEEEEecceeE
Q psy16333         68 LYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCV  101 (192)
Q Consensus        68 l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v  101 (192)
                      |.++=|.-..+|..+. .+.|.||++|+-+.+..
T Consensus         2 L~V~vi~A~~L~~~d~-~g~~dpyv~v~~~~~~~   34 (127)
T cd04022           2 LVVEVVDAQDLMPKDG-QGSSSAYVELDFDGQKK   34 (127)
T ss_pred             eEEEEEEeeCCCCCCC-CCCcCcEEEEEECCEEe
Confidence            3444455556777666 36799999998776543


No 74 
>cd08680 C2_Kibra C2 domain found in Human protein Kibra. Kibra is thought to be a regulator of the Salvador (Sav)/Warts (Wts)/Hippo (Hpo) (SWH) signaling network, which limits tissue growth by inhibiting cell proliferation and promoting apoptosis. The core of the pathway consists of a MST and LATS family kinase cascade that ultimately phosphorylates and inactivates the YAP/Yorkie (Yki) transcription coactivator. The FERM domain proteins Merlin (Mer) and Expanded (Ex) are part of the upstream regulation controlling pathway mechanism.  Kibra colocalizes and associates with Mer and Ex and is thought to transduce an extracellular signal via the SWH network. The apical scaffold machinery that contains Hpo, Wts, and Ex recruits Yki to the apical membrane facilitating its inhibitory phosphorlyation by Wts.  Since Kibra associates with Ex and is apically located it is hypothesized that KIBRA is part of the scaffold, helps in the Hpo/Wts complex, and helps recruit Yki for inactivation that prom
Probab=26.12  E-value=1.2e+02  Score=22.72  Aligned_cols=29  Identities=3%  Similarity=0.169  Sum_probs=22.9

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEE
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIY   95 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~   95 (192)
                      ..|.++=+.-..+|..+. .+.|.||++||
T Consensus        14 ~~L~V~V~~arnL~~~~~-~~~~dpyVKv~   42 (124)
T cd08680          14 SSLVISVEQLRNLSALSI-PENSKVYVRVA   42 (124)
T ss_pred             CEEEEEEeEecCCccccc-CCCCCeEEEEE
Confidence            456667777778888776 47899999999


No 75 
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 3, a member of class 3 synaptotagmins, is located in the brain and localized to the active zone and plasma membrane.  It functions as a Ca2+ sensor for fast exocytosis. It, along with synaptotagmins 5,6, and 10, has disulfide bonds at its N-terminus. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and localized to the synaptic vesicles.  It is thought to be a Ca2+-sensor for dense-core vesicle exocytosis. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind
Probab=25.60  E-value=1.3e+02  Score=22.29  Aligned_cols=30  Identities=20%  Similarity=0.234  Sum_probs=23.7

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++=+.-..+|..+.. +.|.||++|+-
T Consensus        14 ~~L~V~v~~A~~L~~~d~~-g~~dpyvkv~l   43 (134)
T cd08403          14 GRLTLTIIKARNLKAMDIT-GFSDPYVKVSL   43 (134)
T ss_pred             CEEEEEEEEeeCCCccccC-CCCCceEEEEE
Confidence            4477777777888988873 78999999985


No 76 
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as
Probab=25.27  E-value=1.1e+02  Score=23.79  Aligned_cols=34  Identities=12%  Similarity=0.041  Sum_probs=24.0

Q ss_pred             CCCCCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         63 INSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        63 ~~~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      +....|.++=|.-.++|..+...|.|.||++||-
T Consensus        26 y~~~~L~V~Vi~ArnL~~~~~~~g~sDPYVKv~L   59 (146)
T cd04028          26 DKKGQLEVEVIRARGLVQKPGSKVLPAPYVKVYL   59 (146)
T ss_pred             eCCCEEEEEEEEeeCCCcccCCCCCcCCeEEEEE
Confidence            3445577777777788776533366899999996


No 77 
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into 
Probab=25.09  E-value=1.3e+02  Score=21.56  Aligned_cols=31  Identities=13%  Similarity=0.128  Sum_probs=22.8

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++-+.-..+|..+...+.|.||++|+-
T Consensus        14 ~~L~V~v~~a~~L~~~~~~~~~~dpyv~v~l   44 (123)
T cd08521          14 GSLEVHIKECRNLAYADEKKKRSNPYVKVYL   44 (123)
T ss_pred             CEEEEEEEEecCCCCcCCCCCCCCcEEEEEE
Confidence            4466677777788887722478999999985


No 78 
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmin 1, a member of the class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis. It, like synaptotagmin-2, has an N-glycosylated N-terminus. Synaptotagmin 4, a member of class 4 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmin-11, has an Asp to Ser substitution in its C2A domain. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: 
Probab=24.81  E-value=1.3e+02  Score=22.23  Aligned_cols=31  Identities=19%  Similarity=0.261  Sum_probs=23.9

Q ss_pred             CCCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         65 SAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        65 ~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ...|.++-+.-..+|..+. .+.|.||++|+-
T Consensus        14 ~~~l~V~Vi~a~~L~~~d~-~g~~dpyv~v~l   44 (136)
T cd08402          14 AGKLTVVILEAKNLKKMDV-GGLSDPYVKIHL   44 (136)
T ss_pred             CCeEEEEEEEeeCCCcccC-CCCCCCeEEEEE
Confidence            3457777777788888777 367999999986


No 79 
>PF00741 Gas_vesicle:  Gas vesicle protein;  InterPro: IPR000638 Gas vesicles are small, hollow, gas filled protein structures found in several cyanobacterial and archaebacterial microorganisms []. They allow the positioning of the bacteria at the favourable depth for growth. Gas vesicles are hollow cylindrical tubes, closed by a hollow, conical cap at each end. Both the conical end caps and central cylinder are made up of 4-5 nm wide ribs that run at right angles to the long axis of the structure. Gas vesicles seem to be constituted of two different protein components, GVPa and GVPc. GVPa, a small protein of about 70 amino acid residues, is the main constituent of gas vesicles and form the essential core of the structure. The sequence of GVPa is extremely well conserved. GvpJ and gvpM, two proteins encoded in the cluster of genes required for gas vesicle synthesis in the archaebacteria Halobacterium salinarium and Halobacterium mediterranei (Haloferax mediterranei), have been found [] to be evolutionary related to GVPa. The exact function of these two proteins is not known, although they could be important for determining the shape determination gas vesicles. The N-terminal domain of Aphanizomenon flos-aquae protein gvpA/J is also related to GVPa.; GO: 0005198 structural molecule activity, 0012506 vesicle membrane
Probab=24.16  E-value=65  Score=19.88  Aligned_cols=15  Identities=27%  Similarity=0.570  Sum_probs=12.5

Q ss_pred             ccCceEecCeEEEEE
Q psy16333        126 RRGLQLRGDILLKCY  140 (192)
Q Consensus       126 ~~~~~l~GDI~V~~y  140 (192)
                      |+++.+.|||.|.+-
T Consensus        11 dkGvVi~gdi~isva   25 (39)
T PF00741_consen   11 DKGVVIDGDIRISVA   25 (39)
T ss_pred             CCceEEEEEEEEEEc
Confidence            569999999998763


No 80 
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-
Probab=23.99  E-value=1.4e+02  Score=22.24  Aligned_cols=30  Identities=20%  Similarity=0.193  Sum_probs=23.3

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++-|.-..+|..+.. +.|.||++|+-
T Consensus        14 ~~L~V~vi~a~~L~~~d~~-g~~DPyV~v~l   43 (135)
T cd08410          14 GRLNVDIIRAKQLLQTDMS-QGSDPFVKIQL   43 (135)
T ss_pred             CeEEEEEEEecCCCcccCC-CCCCeEEEEEE
Confidence            4567777777788887774 67999999984


No 81 
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular perm
Probab=23.22  E-value=1.9e+02  Score=20.30  Aligned_cols=31  Identities=6%  Similarity=0.083  Sum_probs=21.3

Q ss_pred             EEEEEEEecCCCCCCCCCceeEEEEEEeccee
Q psy16333         69 YLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVC  100 (192)
Q Consensus        69 ~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~  100 (192)
                      .++-+.-..+|..+. .+.+.||++|.-+++.
T Consensus         3 ~V~v~~A~~L~~~~~-~~~~dpyv~v~~~~~~   33 (105)
T cd04050           3 FVYLDSAKNLPLAKS-TKEPSPYVELTVGKTT   33 (105)
T ss_pred             EEEEeeecCCCCccc-CCCCCcEEEEEECCEE
Confidence            344445556777666 3679999999887643


No 82 
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma. A single C2 domain is found in PKC alpha and gamma. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1(alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transd
Probab=23.02  E-value=3e+02  Score=19.99  Aligned_cols=34  Identities=12%  Similarity=0.084  Sum_probs=24.2

Q ss_pred             CCCCCeEEEEEEEecCCCCCCCCCceeEEEEEEec
Q psy16333         63 INSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG   97 (192)
Q Consensus        63 ~~~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~   97 (192)
                      +....|.++-+.-..+|..+.. +.|.||++|+-.
T Consensus        10 ~~~~~l~v~i~~a~nL~~~~~~-~~~dpyv~v~~~   43 (131)
T cd04026          10 VKDNKLTVEVREAKNLIPMDPN-GLSDPYVKLKLI   43 (131)
T ss_pred             ECCCEEEEEEEEeeCCCCcCCC-CCCCCcEEEEEE
Confidence            3445566666666677877663 679999999864


No 83 
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protei
Probab=22.36  E-value=2.4e+02  Score=19.95  Aligned_cols=29  Identities=21%  Similarity=0.184  Sum_probs=20.1

Q ss_pred             EEEEEecCCCCCCCCCceeEEEEEEeccee
Q psy16333         71 THVTVLGAPSFDRCGGGCHAFLKIYEGLVC  100 (192)
Q Consensus        71 ~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~  100 (192)
                      +=+.-.++|..+.. +.|.||++|+-+.+.
T Consensus         5 ~v~~a~~L~~~~~~-~~~dPyv~v~~~~~~   33 (116)
T cd08376           5 VLVEGKNLPPMDDN-GLSDPYVKFRLGNEK   33 (116)
T ss_pred             EEEEEECCCCCCCC-CCCCcEEEEEECCEe
Confidence            33444567776663 679999999986554


No 84 
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulat
Probab=22.33  E-value=1.5e+02  Score=21.25  Aligned_cols=31  Identities=16%  Similarity=0.299  Sum_probs=22.9

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++-+.-..+|..+...+.|.||++|+-
T Consensus        14 ~~L~V~v~~a~~L~~~~~~~~~~dpyV~v~l   44 (123)
T cd08390          14 EQLTVSLIKARNLPPRTKDVAHCDPFVKVCL   44 (123)
T ss_pred             CEEEEEEEEecCCCCccCCCCCCCcEEEEEE
Confidence            3466677777788887722367999999985


No 85 
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=22.28  E-value=1.6e+02  Score=21.84  Aligned_cols=30  Identities=10%  Similarity=0.287  Sum_probs=23.6

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++-+.-.++|..+. .+.|.||++|+-
T Consensus        15 ~~L~v~vi~a~~L~~~~~-~g~~dpyV~v~l   44 (136)
T cd08405          15 NRITVNIIKARNLKAMDI-NGTSDPYVKVWL   44 (136)
T ss_pred             CeEEEEEEEeeCCCcccc-CCCCCceEEEEE
Confidence            457777788888888776 378999999875


No 86 
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=22.22  E-value=1.5e+02  Score=22.54  Aligned_cols=30  Identities=7%  Similarity=0.041  Sum_probs=23.7

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++=+....+|..+. .+.|.||++|+-
T Consensus        15 ~~L~V~VikarnL~~~~~-~~~~dpyVkv~l   44 (138)
T cd08408          15 GRLSVEVIKGSNFKNLAM-NKAPDTYVKLTL   44 (138)
T ss_pred             CeEEEEEEEecCCCcccc-CCCCCeeEEEEE
Confidence            456777778888888776 478999999985


No 87 
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis.  Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 id
Probab=22.12  E-value=1.7e+02  Score=22.05  Aligned_cols=29  Identities=14%  Similarity=0.201  Sum_probs=23.1

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++=+....+|..+ . +.|.||++|+-
T Consensus        15 ~~L~V~V~~a~nL~~~~-~-~~~d~yVkv~l   43 (137)
T cd08409          15 NRLTVVVLRARGLRQLD-H-AHTSVYVKVSL   43 (137)
T ss_pred             CeEEEEEEEecCCCccc-C-CCCCeEEEEEE
Confidence            45777778888888877 3 77999999983


No 88 
>cd04046 C2_Calpain C2 domain present in Calpain proteins. A single C2 domain is found in calpains (EC 3.4.22.52, EC 3.4.22.53), calcium-dependent, non-lysosomal cysteine proteases.  Caplains are classified as belonging to Clan CA by MEROPS and include six families: C1, C2, C10, C12, C28, and C47.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of pic
Probab=21.89  E-value=1.9e+02  Score=21.21  Aligned_cols=24  Identities=29%  Similarity=0.403  Sum_probs=17.3

Q ss_pred             cCCCCCCCCCceeEEEEEEecceeE
Q psy16333         77 GAPSFDRCGGGCHAFLKIYEGLVCV  101 (192)
Q Consensus        77 ~iP~f~~~~~gC~p~i~I~~~~~~v  101 (192)
                      +++..+. .|.|.||++|+.+.+..
T Consensus        14 ~L~~~d~-~g~~dPyv~v~~~~~~~   37 (126)
T cd04046          14 GLSKQDS-GGGADPYVIIKCEGESV   37 (126)
T ss_pred             CCCCCCC-CCCcCccEEEEECCEEE
Confidence            4566555 36799999999876654


No 89 
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as 
Probab=21.85  E-value=1.6e+02  Score=21.08  Aligned_cols=31  Identities=19%  Similarity=0.232  Sum_probs=23.5

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEec
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG   97 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~   97 (192)
                      ..|.++=+.-.++|..+.. +.|.||++|+-.
T Consensus        16 ~~L~V~vi~a~~L~~~~~~-~~~dpyv~v~l~   46 (125)
T cd04031          16 SQLIVTVLQARDLPPRDDG-SLRNPYVKVYLL   46 (125)
T ss_pred             CEEEEEEEEecCCCCcCCC-CCCCCEEEEEEc
Confidence            4466666777788887763 779999999864


No 90 
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=21.65  E-value=3.3e+02  Score=19.89  Aligned_cols=30  Identities=23%  Similarity=0.191  Sum_probs=21.4

Q ss_pred             EEEEEEecCCCCCCCCCceeEEEEEEeccee
Q psy16333         70 LTHVTVLGAPSFDRCGGGCHAFLKIYEGLVC  100 (192)
Q Consensus        70 L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~  100 (192)
                      +.-|.-.++|..+. .+.|.||++|+-+.+.
T Consensus         4 V~Vi~a~~L~~~d~-~g~~DPYv~v~~~~~~   33 (124)
T cd04037           4 VYVVRARNLQPKDP-NGKSDPYLKIKLGKKK   33 (124)
T ss_pred             EEEEECcCCCCCCC-CCCCCcEEEEEECCee
Confidence            34445556787776 3789999999986654


No 91 
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangeme
Probab=21.52  E-value=2e+02  Score=21.32  Aligned_cols=32  Identities=13%  Similarity=-0.030  Sum_probs=21.6

Q ss_pred             eEEEEEEEecCCCCCCCCCceeEEEEEEeccee
Q psy16333         68 LYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVC  100 (192)
Q Consensus        68 l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~  100 (192)
                      |.++=+.=.++|..+. .+.|.||++|+-+.+.
T Consensus         3 l~v~V~~a~~L~~~d~-~g~~dpyv~v~~~~~~   34 (135)
T cd04017           3 LRAYIYQARDLLAADK-SGLSDPFARVSFLNQS   34 (135)
T ss_pred             EEEEEEEeecCcCCCC-CCCCCCEEEEEECCee
Confidence            3344444556777776 3679999999976543


No 92 
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permu
Probab=21.52  E-value=2.3e+02  Score=20.34  Aligned_cols=33  Identities=15%  Similarity=0.203  Sum_probs=20.3

Q ss_pred             EEEEEEecCCCCCC--CCCceeEEEEEEecceeEeec
Q psy16333         70 LTHVTVLGAPSFDR--CGGGCHAFLKIYEGLVCVYTS  104 (192)
Q Consensus        70 L~~I~l~~iP~f~~--~~~gC~p~i~I~~~~~~v~tS  104 (192)
                      +.-+.-..+|..+.  . +.|.||++|+.+.+. +.|
T Consensus         5 v~v~~a~~L~~~~~~~~-~~~dPyv~v~~~~~~-~kT   39 (128)
T cd04024           5 VHVVEAKDLAAKDRSGK-GKSDPYAILSVGAQR-FKT   39 (128)
T ss_pred             EEEEEeeCCCcccCCCC-CCcCCeEEEEECCEE-Eec
Confidence            33344445665554  3 679999999976544 344


No 93 
>cd08677 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domain
Probab=21.43  E-value=1.6e+02  Score=22.18  Aligned_cols=28  Identities=14%  Similarity=0.262  Sum_probs=19.2

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEec
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYEG   97 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~   97 (192)
                      ..|.++-|.-..+|   . .|+|.||++|+-.
T Consensus        14 ~~L~V~vikA~~L~---~-~g~sDPYVKv~L~   41 (118)
T cd08677          14 AELHVNILEAENIS---V-DAGCECYISGCVS   41 (118)
T ss_pred             CEEEEEEEEecCCC---C-CCCCCeEEEEEEc
Confidence            34666666666777   2 2579999999863


No 94 
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=21.33  E-value=1.7e+02  Score=21.07  Aligned_cols=30  Identities=20%  Similarity=0.297  Sum_probs=22.6

Q ss_pred             CCeEEEEEEEecCCCCCCCCCceeEEEEEEe
Q psy16333         66 APLYLTHVTVLGAPSFDRCGGGCHAFLKIYE   96 (192)
Q Consensus        66 ~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~   96 (192)
                      ..|.++=+.-..+|..+. .+.|.||++|+-
T Consensus        15 ~~L~V~v~~a~~L~~~~~-~~~~dpyv~v~~   44 (123)
T cd04035          15 SALHCTIIRAKGLKAMDA-NGLSDPYVKLNL   44 (123)
T ss_pred             CEEEEEEEEeeCCCCCCC-CCCCCceEEEEE
Confidence            346666677778888776 368999999985


No 95 
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism]
Probab=21.21  E-value=47  Score=31.00  Aligned_cols=27  Identities=22%  Similarity=0.109  Sum_probs=21.7

Q ss_pred             hhhHhcC-CeEEEEc--CCCCCceeeeecc
Q psy16333          2 VLELLRS-QSDLKKC--HPSLPYTGVMVSS   28 (192)
Q Consensus         2 ~~~~~~~-nv~vihC--~~G~grtg~~i~~   28 (192)
                      +.+++++ +|..|.=  ..|.||||.|-+|
T Consensus       241 vr~iC~ky~ILlI~DEV~tGFGRTG~~FA~  270 (449)
T COG0161         241 VREICDKYGILLIADEVATGFGRTGKMFAC  270 (449)
T ss_pred             HHHHHHHcCcEEEeecceeCCCcCchhhhh
Confidence            4567777 6777765  6799999999999


No 96 
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrev
Probab=20.97  E-value=2e+02  Score=21.12  Aligned_cols=31  Identities=19%  Similarity=0.268  Sum_probs=20.9

Q ss_pred             EEEEEEEecCCCCCCCCCceeEEEEEEeccee
Q psy16333         69 YLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVC  100 (192)
Q Consensus        69 ~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~  100 (192)
                      .++=+.=.++|..+.. +.|.||++|+.+.+.
T Consensus         4 ~V~vi~a~~L~~~d~~-g~~DPyv~v~~~~~~   34 (127)
T cd04027           4 SITVVCAQGLIAKDKT-GTSDPYVTVQVGKTK   34 (127)
T ss_pred             EEEEEECcCCcCCCCC-CCcCcEEEEEECCEe
Confidence            3344445567777663 679999999986543


No 97 
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I. Rab GTPases recruit various effector proteins to organelles and vesicles.  Rab11-family interacting proteins (FIPs) are involved in mediating the role of Rab11. FIPs can be divided into three classes: class I FIPs (Rip11a, Rip11b, RCP, and FIP2) which contain a C2 domain after N-terminus of the protein, class II FIPs (FIP3 and FIP4) which contain two EF-hands and a proline rich region, and class III FIPs (FIP1) which exhibits no homology to known protein domains. All FIP proteins contain a highly conserved, 20-amino acid motif at the C-terminus of the protein, known as Rab11/25 binding domain (RBD).  Class I FIPs are thought to bind to endocytic membranes via their C2 domain, which interacts directly with phospholipids. Class II FIPs do not have any membrane binding domains leaving much to speculate about the mechanism involving FIP3 and FIP4 interactions with endocytic membranes. The member
Probab=20.73  E-value=1.9e+02  Score=21.11  Aligned_cols=27  Identities=19%  Similarity=0.132  Sum_probs=18.4

Q ss_pred             EEecCCCCCCCCCceeEEEEEEecceeE
Q psy16333         74 TVLGAPSFDRCGGGCHAFLKIYEGLVCV  101 (192)
Q Consensus        74 ~l~~iP~f~~~~~gC~p~i~I~~~~~~v  101 (192)
                      .-.++|..+. .|.|.||++|.-+.+..
T Consensus         7 ~A~~L~~~d~-~g~~dpYv~v~l~~~~~   33 (126)
T cd08682           7 QARGLLCKGK-SGTNDAYVIIQLGKEKY   33 (126)
T ss_pred             ECcCCcCCCC-CcCCCceEEEEECCeee
Confidence            3445666555 36799999998765443


Done!