Query         psy16371
Match_columns 91
No_of_seqs    37 out of 39
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 19:35:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16371.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16371hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1933|consensus               96.0 9.5E-05 2.1E-09   67.8  -7.9   82    4-87    172-255 (1201)
  2 TIGR00917 2A060601 Niemann-Pic  85.1    0.79 1.7E-05   42.4   3.0   76    7-87    434-518 (1204)
  3 COG4099 Predicted peptidase [G  55.9     7.3 0.00016   32.6   1.7   14    3-16    220-233 (387)
  4 PLN02606 palmitoyl-protein thi  42.4      11 0.00023   30.7   0.6   28   13-40    166-195 (306)
  5 KOG3199|consensus               31.3      17 0.00037   28.7   0.2   26    2-31    150-176 (234)
  6 PF05879 RHD3:  Root hair defec  29.9      24 0.00053   31.2   0.9   29    8-39     81-110 (742)
  7 PLN02633 palmitoyl protein thi  28.9      23 0.00051   28.9   0.6   29   13-41    167-197 (314)
  8 PF15040 Humanin:  Humanin fami  28.2     4.6  0.0001   21.7  -2.4   10    7-16      5-14  (24)
  9 PF14636 FNIP_N:  Folliculin-in  27.3      42 0.00091   23.6   1.6   27   48-74     96-125 (131)
 10 PF02089 Palm_thioest:  Palmito  25.9      20 0.00043   28.6  -0.3   28   13-40    153-182 (279)
 11 PF11698 V-ATPase_H_C:  V-ATPas  25.7      29 0.00063   24.5   0.5   32    9-40     16-52  (119)
 12 KOG2541|consensus               22.4      54  0.0012   26.8   1.5   29   13-41    163-193 (296)
 13 cd08073 MPN_NLPC_P60 Mpr1p, Pa  22.0      49  0.0011   22.2   1.1   50    3-53     12-81  (108)
 14 cd02164 PPAT_CoAS phosphopante  20.2      55  0.0012   23.1   1.0   14    5-18     87-100 (143)
 15 KOG1500|consensus               20.1      53  0.0012   28.3   1.1   20    3-22    277-309 (517)

No 1  
>KOG1933|consensus
Probab=96.04  E-value=9.5e-05  Score=67.82  Aligned_cols=82  Identities=20%  Similarity=0.240  Sum_probs=64.5

Q ss_pred             CCCCCCeeeEcCcccchhhhhhhccchh-hhhhhhhccc-cccccchhhhhhhccccccceeeeeeccCceeEEEEEEEE
Q psy16371          4 VLPEYSCLVLSPANLWQQDINMFQKDSQ-LISTIFNHHD-LNKAKVTLSEILFGINIKDTGIRRYSLRNKQRIIQFSVTL   81 (91)
Q Consensus         4 ~lPe~~CLlLSPan~W~~d~~~F~~D~~-ii~TI~~~~~-~~~~~~sl~dlLfGvP~k~TGvk~~~~~~r~R~i~yAVTl   81 (91)
                      +.+||.|..+||++.|++|.+.|..|++ +..+..+|-+ ++..+..+++...  +++-.|++-.++-.+.+++.+|+|+
T Consensus       172 l~i~~~~~~~~~~~~~~~N~~~~~cd~~~v~~c~~~dc~~~c~~~~~~~~~~~--~~~v~~~~~~~~~~~l~~~~~~~~~  249 (1201)
T KOG1933|consen  172 LRIEFLCSLPSPASIWYMNVEVKPCDDDTVPACSCSDCPETCPASLLLKSPTE--TFVVGGIPGLSVFLILAFIFFAALL  249 (1201)
T ss_pred             ceeccccccCCccceeecccccccCCcccccccchhcchhhcCccccCCCCcc--ceeeccccchhHHHHHHHHHHHHHH
Confidence            6789999999999999999999999988 7888888866 4555555555555  6667777776666688888888887


Q ss_pred             EeeccC
Q psy16371         82 FMTKYD   87 (91)
Q Consensus        82 ~l~~y~   87 (91)
                      +|-.|.
T Consensus       250 ~f~~~~  255 (1201)
T KOG1933|consen  250 VFLGYS  255 (1201)
T ss_pred             HHHHHH
Confidence            765543


No 2  
>TIGR00917 2A060601 Niemann-Pick C type protein family. The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis.
Probab=85.13  E-value=0.79  Score=42.40  Aligned_cols=76  Identities=18%  Similarity=0.291  Sum_probs=41.8

Q ss_pred             CCCeeeEcCcccchhhhhhhccc--hhhh-hhhhhc--cccccccchhhhhhhccccccc----eeeeeeccCceeEEEE
Q psy16371          7 EYSCLVLSPANLWQQDINMFQKD--SQLI-STIFNH--HDLNKAKVTLSEILFGINIKDT----GIRRYSLRNKQRIIQF   77 (91)
Q Consensus         7 e~~CLlLSPan~W~~d~~~F~~D--~~ii-~TI~~~--~~~~~~~~sl~dlLfGvP~k~T----Gvk~~~~~~r~R~i~y   77 (91)
                      +++|.+-||+++||+|.+.++.+  ++.+ .+-.+|  ++.....-|+.  .||.|++-.    |++   -.+-.+.-.+
T Consensus       434 ~~~C~v~S~~~yfq~~~~~l~~~~~~~~~~~~~~~~~~~c~~~p~~c~~--~fg~pl~p~~~lgG~~---~~~~~~A~Al  508 (1204)
T TIGR00917       434 PYNCFIYSTCGYFQNMYSKLDPENYDDGFGVDYVKYCFECFTSPESCLS--AFGGPVDPTTALGGFS---GNNFSEASAF  508 (1204)
T ss_pred             CCCCccCCHHHHhccChhhcCcccccccccccHHHhhhccccCcchhcc--cCCCcCCcceeeCCcC---CCCcccceEE
Confidence            58899999999999999999642  2222 122221  11111111221  345554432    332   1233456677


Q ss_pred             EEEEEeeccC
Q psy16371         78 SVTLFMTKYD   87 (91)
Q Consensus        78 AVTl~l~~y~   87 (91)
                      .||..++.++
T Consensus       509 ~lT~~l~n~~  518 (1204)
T TIGR00917       509 VVTFPVNNFV  518 (1204)
T ss_pred             EEEEEEecCC
Confidence            8888888654


No 3  
>COG4099 Predicted peptidase [General function prediction only]
Probab=55.95  E-value=7.3  Score=32.63  Aligned_cols=14  Identities=43%  Similarity=0.707  Sum_probs=12.6

Q ss_pred             cCCCCCCeeeEcCc
Q psy16371          3 GVLPEYSCLVLSPA   16 (91)
Q Consensus         3 ~~lPe~~CLlLSPa   16 (91)
                      ...||++|+||||-
T Consensus       220 wa~pedqcfVlAPQ  233 (387)
T COG4099         220 WAGPEDQCFVLAPQ  233 (387)
T ss_pred             eecccCceEEEccc
Confidence            46899999999997


No 4  
>PLN02606 palmitoyl-protein thioesterase
Probab=42.38  E-value=11  Score=30.66  Aligned_cols=28  Identities=14%  Similarity=0.343  Sum_probs=25.0

Q ss_pred             EcCcccch--hhhhhhccchhhhhhhhhcc
Q psy16371         13 LSPANLWQ--QDINMFQKDSQLISTIFNHH   40 (91)
Q Consensus        13 LSPan~W~--~d~~~F~~D~~ii~TI~~~~   40 (91)
                      +|||++|+  .+.+++.+.+..|..|.++-
T Consensus       166 lv~AqYwrDP~~~~~Yl~~s~FLadINNEr  195 (306)
T PLN02606        166 TAPSGYVKKPMEIKNYLEHSKYLPKLNNER  195 (306)
T ss_pred             EeccccccCcchHHHHHHhCcchhhhcCcC
Confidence            79999999  57899999999999998875


No 5  
>KOG3199|consensus
Probab=31.33  E-value=17  Score=28.73  Aligned_cols=26  Identities=19%  Similarity=0.403  Sum_probs=20.2

Q ss_pred             CcCCCCCCeeeEcCcccch-hhhhhhccchh
Q psy16371          2 VGVLPEYSCLVLSPANLWQ-QDINMFQKDSQ   31 (91)
Q Consensus         2 ~~~lPe~~CLlLSPan~W~-~d~~~F~~D~~   31 (91)
                      .+.+-||||++++    |- +|.+.|-.+.|
T Consensus       150 ~~i~~~yGl~cv~----r~gsD~~~~i~~~d  176 (234)
T KOG3199|consen  150 RTILGEYGLVCVT----REGSDVENFLSSHD  176 (234)
T ss_pred             HHHHhhCcEEEEe----ccCCCHHHHHhccH
Confidence            4567799999999    65 78888887744


No 6  
>PF05879 RHD3:  Root hair defective 3 GTP-binding protein (RHD3);  InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins. It has been speculated that the RHD3 protein is a member of a novel class of GTP-binding proteins that is widespread in eukaryotes and required for regulated cell enlargement []. The family also contains the homologous Saccharomyces cerevisiae synthetic construct enhancement of YOP1 (SEY1) protein which is involved in membrane trafficking [].; GO: 0016817 hydrolase activity, acting on acid anhydrides
Probab=29.89  E-value=24  Score=31.23  Aligned_cols=29  Identities=31%  Similarity=0.749  Sum_probs=24.0

Q ss_pred             CCeeeEcCcccchhhhhhhc-cchhhhhhhhhc
Q psy16371          8 YSCLVLSPANLWQQDINMFQ-KDSQLISTIFNH   39 (91)
Q Consensus         8 ~~CLlLSPan~W~~d~~~F~-~D~~ii~TI~~~   39 (91)
                      ..|||+   |+|.+|+-+++ +.-.+|+|||+-
T Consensus        81 s~~~ii---N~w~~~iG~~~~an~~lLktvfev  110 (742)
T PF05879_consen   81 SDVLII---NMWEHDIGRYQGANMGLLKTVFEV  110 (742)
T ss_pred             hhheee---ehhhhhhhhhcccchHHHHHHHHH
Confidence            356666   99999999998 668899999943


No 7  
>PLN02633 palmitoyl protein thioesterase family protein
Probab=28.92  E-value=23  Score=28.86  Aligned_cols=29  Identities=21%  Similarity=0.488  Sum_probs=25.0

Q ss_pred             EcCcccch--hhhhhhccchhhhhhhhhccc
Q psy16371         13 LSPANLWQ--QDINMFQKDSQLISTIFNHHD   41 (91)
Q Consensus        13 LSPan~W~--~d~~~F~~D~~ii~TI~~~~~   41 (91)
                      ++||++|+  .+.+.+.+.+..|..|.++-+
T Consensus       167 lv~A~Yw~DP~~~d~Yl~~s~FLadINNEr~  197 (314)
T PLN02633        167 LAPSGYYKIPKDVTEYLKGSKYLPKLNNEIP  197 (314)
T ss_pred             cccccccCCchhHHHHHhcCcchhhhhCcCc
Confidence            68999999  478999999999999988754


No 8  
>PF15040 Humanin:  Humanin family; PDB: 2GD3_A 1Y32_A.
Probab=28.15  E-value=4.6  Score=21.67  Aligned_cols=10  Identities=40%  Similarity=0.896  Sum_probs=6.6

Q ss_pred             CCCeeeEcCc
Q psy16371          7 EYSCLVLSPA   16 (91)
Q Consensus         7 e~~CLlLSPa   16 (91)
                      .|+||+||-.
T Consensus         5 GFsCLlL~~~   14 (24)
T PF15040_consen    5 GFSCLLLLTS   14 (24)
T ss_dssp             HHHHHHHHHC
T ss_pred             ccEEEEEEec
Confidence            3678887643


No 9  
>PF14636 FNIP_N:  Folliculin-interacting protein N-terminus
Probab=27.29  E-value=42  Score=23.61  Aligned_cols=27  Identities=19%  Similarity=0.410  Sum_probs=16.7

Q ss_pred             hhhhhhhc-cccccce--eeeeeccCceeE
Q psy16371         48 TLSEILFG-INIKDTG--IRRYSLRNKQRI   74 (91)
Q Consensus        48 sl~dlLfG-vP~k~TG--vk~~~~~~r~R~   74 (91)
                      .|.|++|| +++.+-|  .|=-.++.-+|+
T Consensus        96 ~L~emmFGS~amsYkGsStKvH~ipsp~~~  125 (131)
T PF14636_consen   96 MLGEMMFGSSAMSYKGSSTKVHIIPSPPQL  125 (131)
T ss_pred             HHHHhhhcceeeeeccCceEEEEccCCCcc
Confidence            44599999 7777666  444444454443


No 10 
>PF02089 Palm_thioest:  Palmitoyl protein thioesterase;  InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children. Mutations in the palmitoyl protein thioesterase gene causing infantile neuronal ceroid lipofuscinosis []. The most common mutation results in intracellular accumulation of the polypeptide and undetectable enzyme activity in the brain. Direct sequencing of cDNAs derived from brain RNA of INCL patients has shown a mis-sense transversion of A to T at nucleotide position 364, which results in substitution of Trp for Arg at position 122 in the protein - Arg 122 is immediately adjacent to a lipase consensus sequence that contains the putative active site Ser of PPT. The occurrence of this and two other independent mutations in the PPT gene strongly suggests that defects in this gene cause INCL.; GO: 0008474 palmitoyl-(protein) hydrolase activity, 0006464 protein modification process; PDB: 3GRO_B 1PJA_A 1EXW_A 1EH5_A 1EI9_A.
Probab=25.89  E-value=20  Score=28.63  Aligned_cols=28  Identities=21%  Similarity=0.419  Sum_probs=22.4

Q ss_pred             EcCcccch--hhhhhhccchhhhhhhhhcc
Q psy16371         13 LSPANLWQ--QDINMFQKDSQLISTIFNHH   40 (91)
Q Consensus        13 LSPan~W~--~d~~~F~~D~~ii~TI~~~~   40 (91)
                      ++||++|+  .+.+++.+.+..|..|.++.
T Consensus       153 ~v~AqYwrDP~~~~~Yl~~s~FLadiNNE~  182 (279)
T PF02089_consen  153 LVQAQYWRDPHHEDKYLEYSIFLADINNER  182 (279)
T ss_dssp             TCHGGGB--STTHHHHHHH-SSHHHHTTSS
T ss_pred             EeehhhccCCCcHHHHHHccchhhhhcCCc
Confidence            68999999  67788999999999998775


No 11 
>PF11698 V-ATPase_H_C:  V-ATPase subunit H;  InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins []. This entry represents the C-terminal domain of subunit H (also known as Vma13p) found in the V1 complex of V-ATPases. This subunit has a regulatory function, being responsible for activating ATPase activity and coupling ATPase activity to proton flow []. The yeast enzyme contains five motifs similar to the HEAT or Armadillo repeats seen in the importins, and can be divided into two distinct domains: a large N-terminal domain consisting of stacked alpha helices, and a smaller C-terminal alpha-helical domain with a similar superhelical topology to an armadillo repeat []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0015991 ATP hydrolysis coupled proton transport, 0000221 vacuolar proton-transporting V-type ATPase, V1 domain; PDB: 1HO8_A.
Probab=25.66  E-value=29  Score=24.49  Aligned_cols=32  Identities=19%  Similarity=0.537  Sum_probs=19.4

Q ss_pred             CeeeEcC----cccchhhhhhhcc-chhhhhhhhhcc
Q psy16371          9 SCLVLSP----ANLWQQDINMFQK-DSQLISTIFNHH   40 (91)
Q Consensus         9 ~CLlLSP----an~W~~d~~~F~~-D~~ii~TI~~~~   40 (91)
                      |.|-=||    ..||..|..+|.+ |-.+++.+.+--
T Consensus        16 g~L~WSP~H~se~FW~ENa~kf~~~~~~llk~L~~lL   52 (119)
T PF11698_consen   16 GHLEWSPVHKSEKFWRENADKFEENNFELLKKLIKLL   52 (119)
T ss_dssp             T-----GGGG-HHHHHHHSGGGSSGGGHHHHHHHHHH
T ss_pred             CCccccCCCCCccHHHHHHHHHHHcccHHHHHHHHHH
Confidence            4555566    4689999999974 445777766543


No 12 
>KOG2541|consensus
Probab=22.37  E-value=54  Score=26.82  Aligned_cols=29  Identities=24%  Similarity=0.688  Sum_probs=26.1

Q ss_pred             EcCcccch--hhhhhhccchhhhhhhhhccc
Q psy16371         13 LSPANLWQ--QDINMFQKDSQLISTIFNHHD   41 (91)
Q Consensus        13 LSPan~W~--~d~~~F~~D~~ii~TI~~~~~   41 (91)
                      +||+++|+  ++.+.+.+.+..+.-|.++-+
T Consensus       163 ~a~sgY~~~P~~~d~Yl~~s~fLp~iNnEr~  193 (296)
T KOG2541|consen  163 LAPSGYWHDPHQIDLYLEHSKFLPKINNERP  193 (296)
T ss_pred             ccccccccCchHHHHHHhhchhhhhhcCCCC
Confidence            79999999  889999999999999988864


No 13 
>cd08073 MPN_NLPC_P60 Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding) found in proteins also containing NlpC/P60 domains. This family contains bacterial MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+)-like domains at the N-terminus of NlpC/P60 phage tail protein domains. These domains contain the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity for the release of ubiquitin from ubiquitinated proteins (thus having deubiquitinating (DUB) activity) that are tagged for degradation.  The JAMM proteins likely hydrolyze ubiquitin conjugates in a manner similar to thermolysin, in which the zinc-polarized aqua ligand serves as the nucleophile, compared with the classical DUBs that do so with a cysteine residue in the active site.
Probab=22.05  E-value=49  Score=22.17  Aligned_cols=50  Identities=12%  Similarity=0.270  Sum_probs=33.5

Q ss_pred             cCCCCCCeeeEcC----------cccchhhhhhhccch----------hhhhhhhhccccccccchhhhhh
Q psy16371          3 GVLPEYSCLVLSP----------ANLWQQDINMFQKDS----------QLISTIFNHHDLNKAKVTLSEIL   53 (91)
Q Consensus         3 ~~lPe~~CLlLSP----------an~W~~d~~~F~~D~----------~ii~TI~~~~~~~~~~~sl~dlL   53 (91)
                      .-.|+..|=+|.-          .|.|..-...|.-||          +|+...++|-+ ....-|-.|+.
T Consensus        12 ~~~P~E~CGll~g~~~~~~~~p~~N~~~~p~~~F~idp~e~~~a~~~~~ivgi~HSHP~-~~a~PS~~D~~   81 (108)
T cd08073          12 AEYPREACGLVVRKGRKLRYIPCRNIAADPEEHFEISPEDYAAAEDEGEIVAVVHSHPD-GSPAPSEADRA   81 (108)
T ss_pred             HCCCCcceEEEEecCCceEEEECccCCCCccceEEeCHHHHHHHhcCCCEEEEEEcCCC-CCCCCCHHHHH
Confidence            4578888877765          567776668899888          46666666643 23445666764


No 14 
>cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes. The PPAT domain of the bifunctional enzyme with PPAT and DPCK functions. The final two steps of the CoA biosynthesis pathway are catalyzed by phosphopantetheine adenylyltransferase (PPAT) and dephospho-CoA (dPCoA) kinase (DPCK). The PPAT reaction involves the reversible adenylation of 4'-phosphopantetheine to form 3'-dPCoA and PPi, and DPCK catalyses phosphorylation of the 3'-hydroxy group of the ribose moiety of dPCoA.  In eukaryotes the two enzymes are part of a large multienzyme complex . Studies in Corynebacterium ammoniagenes suggested that separate enzymes were present, and this was confirmed through identification of the bacterial PPAT/CoAD.
Probab=20.19  E-value=55  Score=23.11  Aligned_cols=14  Identities=29%  Similarity=0.603  Sum_probs=11.6

Q ss_pred             CCCCCeeeEcCccc
Q psy16371          5 LPEYSCLVLSPANL   18 (91)
Q Consensus         5 lPe~~CLlLSPan~   18 (91)
                      -|++.||++||-.+
T Consensus        87 ~~~~d~lVVS~ET~  100 (143)
T cd02164          87 DPDLEAIVVSPETY  100 (143)
T ss_pred             CCCCCEEEEcHHHh
Confidence            38999999999654


No 15 
>KOG1500|consensus
Probab=20.15  E-value=53  Score=28.32  Aligned_cols=20  Identities=35%  Similarity=0.732  Sum_probs=17.1

Q ss_pred             cCCCCCCeeeEcC-------------cccchhh
Q psy16371          3 GVLPEYSCLVLSP-------------ANLWQQD   22 (91)
Q Consensus         3 ~~lPe~~CLlLSP-------------an~W~~d   22 (91)
                      .++|.+|=+=++|             ||||+|.
T Consensus       277 kMfPT~gdiHlAPFsDE~Ly~E~~nkAnFWyQq  309 (517)
T KOG1500|consen  277 KMFPTVGDIHLAPFSDEQLYVEQFNKANFWYQQ  309 (517)
T ss_pred             cccCcccceeecccchHHHHHHHHhhhhhhhhh
Confidence            4789999999998             8999863


Done!