Query         psy16407
Match_columns 59
No_of_seqs    48 out of 50
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 20:31:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16407.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16407hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1419|consensus               99.3 3.8E-14 8.3E-19  113.3  -3.8   28   32-59     72-100 (654)
  2 PF06590 PerB:  PerB protein;    67.7     3.4 7.4E-05   28.1   1.4   16   39-54     15-30  (129)
  3 PF02233 PNTB:  NAD(P) transhyd  57.0     8.3 0.00018   30.6   2.0   26    2-27    392-424 (463)
  4 PRK09444 pntB pyridine nucleot  46.8      14  0.0003   29.7   1.8   26    2-27    391-423 (462)
  5 PF14709 DND1_DSRM:  double str  39.0      24 0.00051   21.1   1.6   16   44-59     26-41  (80)
  6 PF11533 DUF3225:  Protein of u  33.9      37  0.0008   23.0   2.1   24   33-58     98-121 (125)
  7 PF06045 Rhamnogal_lyase:  Rham  29.3      36 0.00078   24.4   1.5   16   39-54    126-141 (203)
  8 KOG0537|consensus               28.9      14 0.00031   24.1  -0.5   21   34-54     23-47  (124)
  9 COG4598 HisP ABC-type histidin  25.0      15 0.00032   27.7  -1.1   13   38-50     49-61  (256)
 10 TIGR03665 arCOG04150 arCOG0415  22.2      11 0.00024   25.2  -2.1   12   35-46    152-163 (172)
 11 COG3335 Transposase and inacti  20.5      46 0.00099   18.7   0.6   17    4-20     73-89  (132)

No 1  
>KOG1419|consensus
Probab=99.33  E-value=3.8e-14  Score=113.33  Aligned_cols=28  Identities=68%  Similarity=1.246  Sum_probs=26.1

Q ss_pred             cc-ceecceeeeeeecCCCceeeeeeeeC
Q psy16407         32 AG-ATFQGKVYNFLERPSGWKCFVYHFAV   59 (59)
Q Consensus        32 ~r-r~~Q~rvYNFLERP~Gwk~f~YH~~V   59 (59)
                      +| |++|++||||||||+|||||+|||+|
T Consensus        72 ~r~Rr~q~~vYN~LERPrGWkaf~YH~~V  100 (654)
T KOG1419|consen   72 ARYRRIQNKVYNFLERPRGWKAFLYHFFV  100 (654)
T ss_pred             HHHHHHHHHHHHHHhCCCcchHHHHHHHH
Confidence            44 99999999999999999999999986


No 2  
>PF06590 PerB:  PerB protein;  InterPro: IPR009513 This family consists of several PerB or BfpV proteins found specifically in Escherichia coli. PerB is thought to play a role in regulating the expression of BfpA [].
Probab=67.71  E-value=3.4  Score=28.08  Aligned_cols=16  Identities=38%  Similarity=0.677  Sum_probs=13.9

Q ss_pred             eeeeeeecCCCceeee
Q psy16407         39 KVYNFLERPSGWKCFV   54 (59)
Q Consensus        39 rvYNFLERP~Gwk~f~   54 (59)
                      -|-|.|..|.|||++.
T Consensus        15 gc~nvlslps~wkait   30 (129)
T PF06590_consen   15 GCMNVLSLPSEWKAIT   30 (129)
T ss_pred             ceeeeeecCCcceecc
Confidence            4779999999999974


No 3  
>PF02233 PNTB:  NAD(P) transhydrogenase beta subunit;  InterPro: IPR012136 NAD(P) transhydrogenase catalyses the transfer of reducing equivalents between NAD(H) and NADP(H), coupled to the translocation of protons across a membrane []. It is an integral membrane protein found in most organisms except for yeasts, plants and some bacterial species. In bacterial species it is located in the cytoplasmic membrane, while in mitochondria it is located in the inner membrane. Under most physiological conditions this enzyme synthesises NADPH, driven by consumption of the proton electrochemical gradient. The resulting NADPH is subsequently used for biosynthetic reactions or the reduction of glutathione.  The global structure of this enzyme is similar in all organisms, consisting of three distinct domains, though the polypeptide composition can vary. Domain I binds NAD(+)/NADH, domain II is a hydrophobic membrane-spanning domain, and domain III binds NADP(+)/NADPH. Domain I is composed of two subdomains, both of which form a Rossman fold, while domain III consists of a single Rossman fold where the NADP(+) is flipped relative to the normal orientation of bound nucleotides within the Rossman fold [, , ]. Several residues within these domains are thought to make functionally important interdomain contacts for hydride transfer between these domains []. Proton translocation occurs through domain II and is thought to induce conformational changes which are transmitted across domain III to the site of hydride transfer between domains I and III. This entry represents the beta subunit found in bacterial two-subunit NADP(H) transhydrogenases. This subunit forms domain III and part of the transmembrane domain II. ; GO: 0008750 NAD(P)+ transhydrogenase (AB-specific) activity, 0050661 NADP binding, 0055114 oxidation-reduction process, 0016021 integral to membrane; PDB: 1PT9_A 1DJL_A 1U31_B 2BRU_C 1PTJ_C 1HZZ_C 2FRD_C 2FSV_C 1XLT_C 1U2G_C ....
Probab=56.98  E-value=8.3  Score=30.65  Aligned_cols=26  Identities=19%  Similarity=0.420  Sum_probs=19.0

Q ss_pred             CCCC------CCCCcccC-cchhhhcccceeee
Q psy16407          2 NDTL------NPRSLLTN-PDCRLFDSHYLVKY   27 (59)
Q Consensus         2 ~~~l------~p~~~~~~-p~~~~~~~ry~~~~   27 (59)
                      ||+.      ||.+||++ |.-+.|++|-+.++
T Consensus       392 NDvVNPaA~~d~~SpI~GMPil~v~~ak~Viv~  424 (463)
T PF02233_consen  392 NDVVNPAAREDPNSPIYGMPILEVWKAKQVIVI  424 (463)
T ss_dssp             SGGG-CHHCCSTTSTTTTSS---GGGSSEEEEE
T ss_pred             ccccCchhccCCCCCCCCCeecchhhcCeEEEE
Confidence            7887      57888764 99999999999876


No 4  
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional
Probab=46.81  E-value=14  Score=29.66  Aligned_cols=26  Identities=23%  Similarity=0.548  Sum_probs=21.1

Q ss_pred             CCCC------CCCCccc-Ccchhhhcccceeee
Q psy16407          2 NDTL------NPRSLLT-NPDCRLFDSHYLVKY   27 (59)
Q Consensus         2 ~~~l------~p~~~~~-~p~~~~~~~ry~~~~   27 (59)
                      ||+.      ||.+||+ -|.=+.|++|-..++
T Consensus       391 NDvVNPaA~~dp~SpIyGMPvL~v~kAk~Viv~  423 (462)
T PRK09444        391 NDTVNPAAQEDPNSPIAGMPVLEVWKAQNVIVF  423 (462)
T ss_pred             ccCCCcccccCCCCCcCCCceeehhhCCEEEEE
Confidence            7887      5677865 488889999999876


No 5  
>PF14709 DND1_DSRM:  double strand RNA binding domain from DEAD END PROTEIN 1
Probab=39.00  E-value=24  Score=21.12  Aligned_cols=16  Identities=25%  Similarity=0.495  Sum_probs=13.5

Q ss_pred             eecCCCceeeeeeeeC
Q psy16407         44 LERPSGWKCFVYHFAV   59 (59)
Q Consensus        44 LERP~Gwk~f~YH~~V   59 (59)
                      =+-|.||+-|.|.+.|
T Consensus        26 ~~Gp~~~~~F~ykV~i   41 (80)
T PF14709_consen   26 ESGPDHRKLFLYKVVI   41 (80)
T ss_pred             ccCCCccEEEEEEEEE
Confidence            4689999999999865


No 6  
>PF11533 DUF3225:  Protein of unknown function (DUF3225);  InterPro: IPR024507 This family of proteins has no known function.; PDB: 2OWP_A 2RCD_B.
Probab=33.85  E-value=37  Score=22.95  Aligned_cols=24  Identities=21%  Similarity=0.486  Sum_probs=18.8

Q ss_pred             cceecceeeeeeecCCCceeeeeeee
Q psy16407         33 GATFQGKVYNFLERPSGWKCFVYHFA   58 (59)
Q Consensus        33 rr~~Q~rvYNFLERP~Gwk~f~YH~~   58 (59)
                      +.-.|.++|-=+  |.|||...=|++
T Consensus        98 ~~GRQsQtWvr~--~~gWrIvaAHVS  121 (125)
T PF11533_consen   98 RIGRQSQTWVRF--PDGWRIVAAHVS  121 (125)
T ss_dssp             CEEEEEEEEEEE--TTEEEEEEEEEE
T ss_pred             ceeEeEEEEEEC--CCCEEEEEEEEe
Confidence            456788877554  789999999986


No 7  
>PF06045 Rhamnogal_lyase:  Rhamnogalacturonate lyase family;  InterPro: IPR010325 Rhamnogalacturonate lyase degrades the rhamnogalacturonan I (RG-I) backbone of pectin []. This family contains mainly members from plants, but also contains the plant pathogen Erwinia chrysanthemi.
Probab=29.29  E-value=36  Score=24.45  Aligned_cols=16  Identities=38%  Similarity=0.939  Sum_probs=12.2

Q ss_pred             eeeeeeecCCCceeee
Q psy16407         39 KVYNFLERPSGWKCFV   54 (59)
Q Consensus        39 rvYNFLERP~Gwk~f~   54 (59)
                      .+|.-+|+|.||.+|-
T Consensus       126 Y~YAI~e~~~~~Pa~~  141 (203)
T PF06045_consen  126 YSYAIFEHPAGWPAFD  141 (203)
T ss_pred             EEEEEEecCCCCCCcc
Confidence            3555699999998763


No 8  
>KOG0537|consensus
Probab=28.95  E-value=14  Score=24.10  Aligned_cols=21  Identities=38%  Similarity=0.759  Sum_probs=16.8

Q ss_pred             ceecceeeee---e-ecCCCceeee
Q psy16407         34 ATFQGKVYNF---L-ERPSGWKCFV   54 (59)
Q Consensus        34 r~~Q~rvYNF---L-ERP~Gwk~f~   54 (59)
                      --+.++||+.   | |+|-|++.+.
T Consensus        23 vii~gkVYDvT~Fl~eHPGG~~vLl   47 (124)
T KOG0537|consen   23 VIIHGKVYDVTSFLDEHPGGEDVLL   47 (124)
T ss_pred             EEECCEEEeccchhhhCCChHHHHH
Confidence            5688999985   6 8999987654


No 9  
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]
Probab=24.96  E-value=15  Score=27.65  Aligned_cols=13  Identities=46%  Similarity=0.641  Sum_probs=10.7

Q ss_pred             ceeeeeeecCCCc
Q psy16407         38 GKVYNFLERPSGW   50 (59)
Q Consensus        38 ~rvYNFLERP~Gw   50 (59)
                      -||-||||.|.-=
T Consensus        49 LRCiN~LE~P~~G   61 (256)
T COG4598          49 LRCINFLEKPSAG   61 (256)
T ss_pred             HHHHHhhcCCCCc
Confidence            4799999999753


No 10 
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein. This family of proteins is universal among the 41 archaeal genomes analyzed in and is not observed outside of the archaea. The proteins contain a single KH domain (pfam00013) which is likely to confer the ability to bind RNA.
Probab=22.21  E-value=11  Score=25.22  Aligned_cols=12  Identities=58%  Similarity=0.999  Sum_probs=9.4

Q ss_pred             eecceeeeeeec
Q psy16407         35 TFQGKVYNFLER   46 (59)
Q Consensus        35 ~~Q~rvYNFLER   46 (59)
                      +.++.||||||+
T Consensus       152 ~~~~~vy~~l~~  163 (172)
T TIGR03665       152 APHGTVYKFLER  163 (172)
T ss_pred             CCChhHHHHHHH
Confidence            467788888886


No 11 
>COG3335 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.54  E-value=46  Score=18.66  Aligned_cols=17  Identities=29%  Similarity=0.139  Sum_probs=15.1

Q ss_pred             CCCCCCcccCcchhhhc
Q psy16407          4 TLNPRSLLTNPDCRLFD   20 (59)
Q Consensus         4 ~l~p~~~~~~p~~~~~~   20 (59)
                      .|+|+.|...|+++.|.
T Consensus        73 flp~y~p~~n~ie~~~~   89 (132)
T COG3335          73 FLPPYSPDLNPIEYAWK   89 (132)
T ss_pred             EcCCCCCCccHHHHHHH
Confidence            46899999999999886


Done!