Diaphorina citri psyllid: psy16411


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
VWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVSKIVLHNAARVAEVWMDEWRDFYYAMNPGKSASVWMCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWQCGGILEIIPCSHVGHVFRDKSPYTYLNPLGAASVDVGDVSERKELRERLQCKSFRWYLENVYPESQMPLDYYYLGEVKNAETLNCLDTMGRKTGEKVVIPG
ccCCccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccEEEcccEEEEEccccCEEEEccccccccccccccHHccccEEEEEEEccccccEECccccccccHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccCEEEEECcccccccccccccccccEEccc
VWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVSKIVLHNAARVAEVWMDEWRDFYYAMNPGKSASVWMCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWQCGGILEIIPCSHVGHVFRDKSPYTYLNPLGAASVDVGDVSERKELRERLQCKSFRWYLENVYPESQMPLDYYYLGEVKNAETLNCLDTMG*K******IP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVSKIVLHNAARVAEVWMDEWRDFYYAMNPGKSASVWMCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWQCGGILEIIPCSHVGHVFRDKSPYTYLNPLGAASVDVGDVSERKELRERLQCKSFRWYLENVYPESQMPLDYYYLGEVKNAETLNCLDTMGRKTGEKVVIPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypeptide N-acetylgalactosaminyltransferase 5 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It can both act as a peptide transferase that transfers GalNAc onto unmodified peptide substrates, and as a glycopeptide transferase that requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Prefers EA2 as substrate.confidentQ6WV17
Polypeptide N-acetylgalactosaminyltransferase 13 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a much stronger activity than GALNT1 to transfer GalNAc to mucin peptides, such as Muc5Ac and Muc7. Able to glycosylate SDC3. May be responsible for the synthesis of Tn antigen in neuronal cells.confidentQ6UE39
Polypeptide N-acetylgalactosaminyltransferase 13 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a much stronger activity than GALNT1 to transfer GalNAc to mucin peptides, such as Muc5Ac and Muc7. Able to glycosylate SDC3. May be responsible for the synthesis of Tn antigen in neuronal cells.confidentQ8IUC8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004653 [MF]polypeptide N-acetylgalactosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008376, GO:0008194
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009312 [BP]oligosaccharide biosynthetic processprobableGO:1901576, GO:0005975, GO:0044238, GO:0009311, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0044723
GO:0006493 [BP]protein O-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XHB, chain A
Confidence level:very confident
Coverage over the Query: 1-20,33-62,145-213
View the alignment between query and template
View the model in PyMOL
Template: 1XHB, chain A
Confidence level:very confident
Coverage over the Query: 72-212
View the alignment between query and template
View the model in PyMOL