RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16416
         (64 letters)



>gnl|CDD|218628 pfam05541, Spheroidin, Entomopoxvirus spheroidin protein.
           Entomopoxviruses (EPVs) are large (300-400 nm)
           oval-shaped viruses replicating in the cytoplasm of
           their insect host cells. At the end of their replicative
           cycle EPVs virions are occluded in a highly expressed
           protein called spheroidin. This protein forms large
           (5-20 mm long) oval-shaped occlusion bodies (OBs) called
           spherules. The infectious cycle of EPVs begins with the
           ingestion by the insect host of the spherules, their
           dissolution by the alkaline reducing conditions of the
           midgut fluid and the release of virions in the midgut
           lumen. The infective particles first replicate in midgut
           epithelial cells, then pass the gut barrier to colonise
           the internal tissues, mainly the fat body cells. Whilst
           spheroidin has been demonstrated to be non-essential for
           viral replication, it plays an essential role in the
           natural biological cycle of the virus in protecting
           virions from adverse environmental conditions (e.g. UV
           degradation) and thus improving transmission efficacy.
           In this respect, spheroidins are functionally similar to
           polyhedrins of baculoviruses or cypoviruses.
          Length = 943

 Score = 24.8 bits (54), Expect = 3.0
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 3   LDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDR 59
           L  YY  EV N      L ++ +K GE +V N  TG     N + ++N   +I ++R
Sbjct: 219 LSIYY--EVNNNAQKKLLKSLLQKYGEFDVYNADTGLVYAKNLSIKENTTYVIQVER 273


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.317    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0606    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,074,174
Number of extensions: 196254
Number of successful extensions: 142
Number of sequences better than 10.0: 1
Number of HSP's gapped: 142
Number of HSP's successfully gapped: 2
Length of query: 64
Length of database: 10,937,602
Length adjustment: 35
Effective length of query: 29
Effective length of database: 9,385,212
Effective search space: 272171148
Effective search space used: 272171148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (24.5 bits)