RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy16416
(64 letters)
>gnl|CDD|218628 pfam05541, Spheroidin, Entomopoxvirus spheroidin protein.
Entomopoxviruses (EPVs) are large (300-400 nm)
oval-shaped viruses replicating in the cytoplasm of
their insect host cells. At the end of their replicative
cycle EPVs virions are occluded in a highly expressed
protein called spheroidin. This protein forms large
(5-20 mm long) oval-shaped occlusion bodies (OBs) called
spherules. The infectious cycle of EPVs begins with the
ingestion by the insect host of the spherules, their
dissolution by the alkaline reducing conditions of the
midgut fluid and the release of virions in the midgut
lumen. The infective particles first replicate in midgut
epithelial cells, then pass the gut barrier to colonise
the internal tissues, mainly the fat body cells. Whilst
spheroidin has been demonstrated to be non-essential for
viral replication, it plays an essential role in the
natural biological cycle of the virus in protecting
virions from adverse environmental conditions (e.g. UV
degradation) and thus improving transmission efficacy.
In this respect, spheroidins are functionally similar to
polyhedrins of baculoviruses or cypoviruses.
Length = 943
Score = 24.8 bits (54), Expect = 3.0
Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 2/57 (3%)
Query: 3 LDYYYLGEVKNAETLNCLDTMGRKTGEKNVKNTRTGPKCFDNYTAEDNKYIIIYLDR 59
L YY EV N L ++ +K GE +V N TG N + ++N +I ++R
Sbjct: 219 LSIYY--EVNNNAQKKLLKSLLQKYGEFDVYNADTGLVYAKNLSIKENTTYVIQVER 273
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.317 0.137 0.417
Gapped
Lambda K H
0.267 0.0606 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,074,174
Number of extensions: 196254
Number of successful extensions: 142
Number of sequences better than 10.0: 1
Number of HSP's gapped: 142
Number of HSP's successfully gapped: 2
Length of query: 64
Length of database: 10,937,602
Length adjustment: 35
Effective length of query: 29
Effective length of database: 9,385,212
Effective search space: 272171148
Effective search space used: 272171148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (24.5 bits)