Diaphorina citri psyllid: psy16417

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12

MVHKNDGKTVVCPIIDVISDQTFEYITASDMTWGGFNWKLNFRWYRVPPREMMRRGGDRSSPLRTPTMAGGLFAIDKDYFYELGSYDEGMDIWGGENLEMSFRGKCEIFAYVDKERTE

ccccccccEEEEEcccEEcccccEEEEcccccCEEECccEEEEEECccHHHHHHccccccccccccccccCEEEECHHHHHHHccccccccccccCEEEEEEEEEccEEEEEEccccc

MVHKNDGKTVVCPIIDVISDQTFEYITASDMTWGGFNWKLNFRWYRVPPREM*RRGGDRSSPLRTPTMAGGLFAIDKDYFYELGSYDEGMDIWGGENLEMSFRGKCEIFAYVDK****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVHKNDGKTVVCPIIDVISDQTFEYITASDMTWGGFNWKLNFRWYRVPPREMMRRGGDRSSPLRTPTMAGGLFAIDKDYFYELGSYDEGMDIWGGENLEMSFRGKCEIFAYVDKERTE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Polypeptide N-acetylgalactosaminyltransferase 3	Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.	confident	P34678
Polypeptide N-acetylgalactosaminyltransferase 1	Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.	confident	Q07537
Polypeptide N-acetylgalactosaminyltransferase 1	Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.	confident	Q10473

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004653 [MF]	polypeptide N-acetylgalactosaminyltransferase activity	confident	GO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008376, GO:0008194
GO:0006493 [BP]	protein O-linked glycosylation	confident	GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016266 [BP]	O-glycan processing	probable	GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0030145 [MF]	manganese ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0009312 [BP]	oligosaccharide biosynthetic process	probable	GO:1901576, GO:0005975, GO:0044238, GO:0009311, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0044723
GO:0018243 [BP]	protein O-linked glycosylation via threonine	probable	GO:0044237, GO:0044249, GO:0018210, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0018242 [BP]	protein O-linked glycosylation via serine	probable	GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0018209, GO:0044238, GO:0006493, GO:0006486, GO:0005975, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0032580 [CC]	Golgi cisterna membrane	probable	GO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031985, GO:0031984, GO:0031090, GO:0016020, GO:0044431, GO:0005795, GO:0005794, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0002378 [BP]	immunoglobulin biosynthetic process	probable	GO:1901576, GO:0071704, GO:0043170, GO:0002376, GO:0002377, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0002440
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0043687 [BP]	post-translational protein modification	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005576 [CC]	extracellular region	probable	GO:0005575

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XHB, chain A
Confidence level:very confident
Coverage over the Query: 3-114
View the alignment between query and template
View the model in PyMOL