Query         psy16431
Match_columns 87
No_of_seqs    104 out of 243
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 21:09:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16431.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16431hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2265|consensus              100.0 5.5E-38 1.2E-42  228.4   5.1   87    1-87     93-179 (179)
  2 cd06465 p23_hB-ind1_like p23_l  95.8  0.0051 1.1E-07   40.2   1.7   30    1-30     74-103 (108)
  3 TIGR00600 rad2 DNA excision re  84.4       1 2.2E-05   40.8   3.3   52   18-83    181-233 (1034)
  4 PF05902 4_1_CTD:  4.1 protein   76.8     3.6 7.7E-05   28.6   3.2   16   65-80     87-102 (114)
  5 PF14357 DUF4404:  Domain of un  64.7      29 0.00064   22.3   5.4   48   32-79     16-69  (85)
  6 KOG2265|consensus               58.2     3.1 6.7E-05   30.9  -0.1   26   61-86    120-145 (179)
  7 PF11985 DUF3486:  Protein of u  47.2      12 0.00026   26.6   1.4   23   28-50      3-25  (180)
  8 PF15141 DUF4574:  Domain of un  47.1      12 0.00025   24.7   1.3   22   57-78     26-47  (84)
  9 COG3678 CpxP P pilus assembly/  47.0      26 0.00056   25.2   3.1   36   32-67     55-90  (160)
 10 PF00645 zf-PARP:  Poly(ADP-rib  45.4      22 0.00048   21.8   2.3   24   20-47     58-81  (82)
 11 PHA00159 endonuclease I         41.4      30 0.00066   25.0   2.7   26   56-84     68-97  (148)
 12 PF10929 DUF2811:  Protein of u  41.1      24 0.00052   21.7   1.9   15   66-80     11-25  (57)
 13 PF12585 DUF3759:  Protein of u  40.6      41  0.0009   22.6   3.1   25   47-72     31-55  (93)
 14 cd01388 SOX-TCF_HMG-box SOX-TC  31.9 1.1E+02  0.0025   18.0   4.4   19   64-82     54-72  (72)
 15 PF05367 Phage_endo_I:  Phage e  31.8      39 0.00085   24.5   2.1   22   56-80     68-89  (149)
 16 PF08863 YolD:  YolD-like prote  31.8      98  0.0021   18.8   3.7   37   37-75      2-38  (92)
 17 PF08897 DUF1841:  Domain of un  30.9 1.3E+02  0.0029   21.3   4.6   39   39-80      2-41  (137)
 18 PRK13676 hypothetical protein;  29.7 1.6E+02  0.0034   19.2   4.6   44   36-79     35-83  (114)
 19 cd05837 MSH6_like The PWWP dom  28.6      29 0.00063   23.0   0.9   20    2-21     11-30  (110)
 20 cd08470 PBP2_CrgA_like_1 The C  28.4      33 0.00071   21.9   1.1   18   65-82     16-33  (197)
 21 PF11590 DNAPolymera_Pol:  DNA   28.2      55  0.0012   18.9   1.9   32   41-72      5-36  (41)
 22 PF13801 Metal_resist:  Heavy-m  27.7 1.5E+02  0.0033   18.1   5.9   42   33-74     40-98  (125)
 23 PF11637 UvsW:  ATP-dependant D  27.1      56  0.0012   19.9   1.9   24   47-70     16-39  (54)
 24 KOG4260|consensus               26.9      53  0.0011   26.6   2.2   32   51-82     60-93  (350)
 25 TIGR03830 CxxCG_CxxCG_HTH puta  26.0 1.4E+02  0.0031   19.1   3.9   35   32-66     39-73  (127)
 26 PF08947 BPS:  BPS (Between PH   25.4      21 0.00045   21.4  -0.2    8   78-85     10-17  (49)
 27 cd08477 PBP2_CrgA_like_8 The C  24.8      46 0.00099   21.1   1.3   17   66-82     17-33  (197)
 28 cd08486 PBP2_CbnR The C-termin  24.2      42 0.00092   21.9   1.1   18   65-82     16-33  (198)
 29 PRK13798 putative OHCU decarbo  23.9      87  0.0019   22.4   2.7   48   10-58     64-115 (166)
 30 cd08466 PBP2_LeuO The C-termin  23.6      50  0.0011   21.1   1.3   18   65-82     15-32  (200)
 31 cd08438 PBP2_CidR The C-termin  23.5      45 0.00098   21.0   1.1   18   65-82     15-32  (197)
 32 cd05838 WHSC1_related The PWWP  23.1      39 0.00084   21.9   0.7   20    2-21      9-28  (95)
 33 cd08476 PBP2_CrgA_like_7 The C  23.0      46 0.00099   21.0   1.0   17   66-82     15-31  (197)
 34 PF08909 DUF1854:  Domain of un  23.0      55  0.0012   23.1   1.5   16   31-46     36-51  (133)
 35 cd08418 PBP2_TdcA The C-termin  22.2      55  0.0012   20.7   1.3   18   65-82     15-32  (201)
 36 cd08422 PBP2_CrgA_like The C-t  22.1      46   0.001   20.9   0.9   18   65-82     16-33  (197)
 37 TIGR02739 TraF type-F conjugat  21.5 3.7E+02   0.008   20.6   5.9   49   35-83     57-121 (256)
 38 cd08440 PBP2_LTTR_like_4 TThe   21.4      58  0.0013   20.3   1.3   18   65-82     15-32  (197)
 39 cd08452 PBP2_AlsR The C-termin  21.3      57  0.0012   21.0   1.3   18   65-82     15-32  (197)
 40 cd08450 PBP2_HcaR The C-termin  21.3      55  0.0012   20.7   1.1   18   65-82     15-32  (196)
 41 cd08464 PBP2_DntR_like_2 The C  21.3      58  0.0013   20.7   1.3   18   65-82     15-32  (200)
 42 cd08471 PBP2_CrgA_like_2 The C  21.3      59  0.0013   20.7   1.3   18   65-82     16-33  (201)
 43 cd08472 PBP2_CrgA_like_3 The C  20.8      61  0.0013   20.6   1.3   18   65-82     16-33  (202)
 44 cd08415 PBP2_LysR_opines_like   20.7      61  0.0013   20.4   1.3   17   66-82     16-32  (196)
 45 PF12995 DUF3879:  Domain of un  20.5 3.8E+02  0.0081   20.1   6.1   68   10-77     58-126 (186)
 46 cd08474 PBP2_CrgA_like_5 The C  20.4      55  0.0012   20.9   1.0   18   65-82     18-35  (202)
 47 cd08481 PBP2_GcdR_like The C-t  20.3      54  0.0012   20.6   1.0   17   66-82     16-32  (194)
 48 PF15060 PPDFL:  Differentiatio  20.3      54  0.0012   22.6   1.0   19    1-19     46-64  (110)
 49 cd08463 PBP2_DntR_like_4 The C  20.2      63  0.0014   21.3   1.3   19   64-82     14-32  (203)
 50 cd08417 PBP2_Nitroaromatics_li  20.2      57  0.0012   20.7   1.1   18   65-82     15-32  (200)
 51 PF07055 Eno-Rase_FAD_bd:  Enoy  20.2 1.1E+02  0.0023   19.2   2.2   33   34-74     14-46  (65)
 52 cd08435 PBP2_GbpR The C-termin  20.2      58  0.0012   20.6   1.1   19   64-82     14-32  (201)
 53 cd08451 PBP2_BudR The C-termin  20.0      62  0.0013   20.5   1.2   16   66-81     17-32  (199)

No 1  
>KOG2265|consensus
Probab=100.00  E-value=5.5e-38  Score=228.41  Aligned_cols=87  Identities=74%  Similarity=1.148  Sum_probs=84.7

Q ss_pred             CccccccccccccccCCcccccccCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHHHhCCCCC
Q psy16431          1 MEKINKMEWWSKLVTTDPEINTKKINPEPSKLSDLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFMEQHPEMD   80 (87)
Q Consensus         1 L~K~~~~~WW~~vl~GdpeID~~kI~~~~~~l~dlD~etq~~veKmm~dq~qK~~G~ptsde~k~~e~Lkkf~~~~p~~d   80 (87)
                      |+|.++|+||+|+|+|+|+||+.+|+|+.+++++||++||++|+||||||+||.+|+|+||+.+++++|++||++||+||
T Consensus        93 l~K~~~~eWW~~ll~gep~ID~~ki~~e~skl~dldeEtra~vekmmfdq~qk~~~~p~sde~~~~d~Lkk~~~~~~~~~  172 (179)
T KOG2265|consen   93 LKKSNKMEWWDSLLEGEPEIDTKKIEPEESKLSDLDEETRATVEKMMFDQRQKSMGLPTSDELKKHDMLKKFMDQHPEMD  172 (179)
T ss_pred             eeccchHHHHHHHHcCCCCCCccccChhhhhhhhccHHHHHhhhccchhHHHhhcCCCCCchhhHHHHHHHHHHhCCCCC
Confidence            57888899999999999999999999988899999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCC
Q psy16431         81 FSNCKFG   87 (87)
Q Consensus        81 fs~~~~~   87 (87)
                      ||+|+||
T Consensus       173 f~~a~~~  179 (179)
T KOG2265|consen  173 FSNAKFN  179 (179)
T ss_pred             CchhccC
Confidence            9999997


No 2  
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins. hB-ind1 participates in signaling by the small GTPase Rac1. It binds to Rac1 and enhances different Rac1 effects including activation of nuclear factor (NF) kappaB and activation of c-Jun N-terminal kinase (JNK). hB-ind1 also plays a part in the RNA replication and particle production of Hepatitis C virus (HCV)  through its interaction with heat shock protein Hsp90, HCV nonstructural protein 5A (NS5A), and the immunophilin FKBP8.  hB-ind1 is upregulated in the outer layer of Chinese hamster V79 cells grown as multicell spheroids, versus in the same cells grown as monolayers. This group includes the Saccharomyces cerevisiae Sba1, a co-chaperone of the Hsp90. Sba1 has been shown to be is required for telomere length maintenance, and may modulate telomerase DNA-binding activity.
Probab=95.85  E-value=0.0051  Score=40.22  Aligned_cols=30  Identities=17%  Similarity=0.337  Sum_probs=25.8

Q ss_pred             CccccccccccccccCCcccccccCCCCCC
Q psy16431          1 MEKINKMEWWSKLVTTDPEINTKKINPEPS   30 (87)
Q Consensus         1 L~K~~~~~WW~~vl~GdpeID~~kI~~~~~   30 (87)
                      |.|...+.||++|.+|+++++..+|+.++.
T Consensus        74 L~K~~~~~~W~~L~~~~~k~~~~~~d~~~w  103 (108)
T cd06465          74 LRKKEAGEYWPRLTKEKGKLPWLKVDFDKW  103 (108)
T ss_pred             EEECCCCCCCcccccCCCCCCceECCchhc
Confidence            567763579999999999999999999874


No 3  
>TIGR00600 rad2 DNA excision repair protein (rad2). All proteins in this family for which functions are known are flap endonucleases that generate the 3' incision next to DNA damage as part of nucleotide excision repair. This family is related to many other flap endonuclease families including the fen1 family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=84.41  E-value=1  Score=40.76  Aligned_cols=52  Identities=23%  Similarity=0.176  Sum_probs=40.3

Q ss_pred             cccccccCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHHHhCCC-CCCCC
Q psy16431         18 PEINTKKINPEPSKLSDLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFMEQHPE-MDFSN   83 (87)
Q Consensus        18 peID~~kI~~~~~~l~dlD~etq~~veKmm~dq~qK~~G~ptsde~k~~e~Lkkf~~~~p~-~dfs~   83 (87)
                      --+|+.+|++....+..|+.++|..|-.-|-.-++-+|              .+|-+..|+ ||||.
T Consensus       181 ~~~d~~~ID~~S~~F~sLP~~~qyeILs~lRlrSRlRm--------------eQLeemfpdSmDFSk  233 (1034)
T TIGR00600       181 FFHNPSAIDIESEEFSSLPPEVKHEILTDMKLFTKRRR--------------TLFEAMPENSMDFSQ  233 (1034)
T ss_pred             ccCChhhcCCCCHHHHhCCHHHHHHHHHHHHHHHHHHH--------------HHHhhcCCCchhhhH
Confidence            45899999999889999999999999776654444333              666667776 88885


No 4  
>PF05902 4_1_CTD:  4.1 protein C-terminal domain (CTD);  InterPro: IPR008379 There is a unique sequence domain at the C terminus of all known 4.1 proteins, known as the C-terminal domain (CTD). Mammalian CTDs are associated with a growing number of protein-protein interactions, although such activities have yet to be associated with invertebrate CTDs. Mammalian CTDs are generally defined by sequence alignment as encoded by exons 18-21. Comparison of known vertebrate 4.1 proteins with invertebrate 4.1 proteins indicates that mammalian 4.1 exon 19 represents a vertebrate adaptation that extends the sequence of the CTD with a Ser/Thr-rich sequence. The CTD was first described as a 22/24 kDa domain by chymotryptic digestion of erythrocyte 4.1 (4.1R). CTD is thought to represent an independent folding structure which has gained function since the divergence of vertebrates from invertebrates [].; GO: 0003779 actin binding, 0005198 structural molecule activity, 0005856 cytoskeleton
Probab=76.75  E-value=3.6  Score=28.57  Aligned_cols=16  Identities=38%  Similarity=0.617  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHhCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMD   80 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~d   80 (87)
                      -...++.++++||+|-
T Consensus        87 La~aI~eAk~q~Pdm~  102 (114)
T PF05902_consen   87 LAQAIKEAKEQHPDMS  102 (114)
T ss_pred             HHHHHHHHHHhCCCce
Confidence            3457788899999984


No 5  
>PF14357 DUF4404:  Domain of unknown function (DUF4404)
Probab=64.74  E-value=29  Score=22.25  Aligned_cols=48  Identities=21%  Similarity=0.272  Sum_probs=33.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHcCC-----CC-cHHHHHHHHHHHHHHhCCCC
Q psy16431         32 LSDLDGETRGLVEKMMYDQRQKEMGL-----PT-SDEQKKQDVLKKFMEQHPEM   79 (87)
Q Consensus        32 l~dlD~etq~~veKmm~dq~qK~~G~-----pt-sde~k~~e~Lkkf~~~~p~~   79 (87)
                      ...+|+++++.+..++-|-+...-..     +. +--.+......+|-..||.+
T Consensus        16 ~~~ld~~~~~~L~~l~~dIe~~L~~~~~~~~~~~~l~d~l~~av~~FE~~HP~l   69 (85)
T PF14357_consen   16 NPPLDEETRAELSSLDDDIEAQLAEEDEAEAEDESLVDRLNEAVERFEASHPKL   69 (85)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHhcCCcccccchhHHHHHHHHHHHHHHhCCcH
Confidence            45689999999999998876654441     11 11234455778899999974


No 6  
>KOG2265|consensus
Probab=58.21  E-value=3.1  Score=30.89  Aligned_cols=26  Identities=19%  Similarity=0.169  Sum_probs=21.9

Q ss_pred             HHHHHHHHHHHHHHhCCCCCCCCCCC
Q psy16431         61 DEQKKQDVLKKFMEQHPEMDFSNCKF   86 (87)
Q Consensus        61 de~k~~e~Lkkf~~~~p~~dfs~~~~   86 (87)
                      ++-+..+++++|++..|.|+|+++.+
T Consensus       120 e~skl~dldeEtra~vekmmfdq~qk  145 (179)
T KOG2265|consen  120 EESKLSDLDEETRATVEKMMFDQRQK  145 (179)
T ss_pred             hhhhhhhccHHHHHhhhccchhHHHh
Confidence            34577888999999999999998764


No 7  
>PF11985 DUF3486:  Protein of unknown function (DUF3486);  InterPro: IPR021874 This entry is represented by Bacteriophage Mu, Gp27. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=47.21  E-value=12  Score=26.56  Aligned_cols=23  Identities=30%  Similarity=0.394  Sum_probs=19.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHH
Q psy16431         28 EPSKLSDLDGETRGLVEKMMYDQ   50 (87)
Q Consensus        28 ~~~~l~dlD~etq~~veKmm~dq   50 (87)
                      .+|+|+-||++.|..|..|+-+.
T Consensus         3 r~SkId~LP~eir~~l~~~L~~~   25 (180)
T PF11985_consen    3 RRSKIDLLPPEIREWLDQMLRDG   25 (180)
T ss_pred             CCchHhhCCHHHHHHHHHHHHhC
Confidence            35789999999999999988774


No 8  
>PF15141 DUF4574:  Domain of unknown function (DUF4574)
Probab=47.06  E-value=12  Score=24.73  Aligned_cols=22  Identities=45%  Similarity=0.705  Sum_probs=15.3

Q ss_pred             CCCcHHHHHHHHHHHHHHhCCC
Q psy16431         57 LPTSDEQKKQDVLKKFMEQHPE   78 (87)
Q Consensus        57 ~ptsde~k~~e~Lkkf~~~~p~   78 (87)
                      +-||-+++|++|||..-++||-
T Consensus        26 LvtPgeerK~e~lK~~pe~~p~   47 (84)
T PF15141_consen   26 LVTPGEERKQEMLKEMPEQNPR   47 (84)
T ss_pred             EeCCcHHHHHHHHHHccccCch
Confidence            3456677777788777777764


No 9  
>COG3678 CpxP P pilus assembly/Cpx signaling pathway, periplasmic inhibitor/zinc-resistance associated protein [Intracellular trafficking and secretion / Cell motility and secretio / Signal transduction mechanisms / Inorganic ion transport and metabolism]
Probab=46.95  E-value=26  Score=25.19  Aligned_cols=36  Identities=19%  Similarity=0.206  Sum_probs=24.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHcCCCCcHHHHHHH
Q psy16431         32 LSDLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQD   67 (87)
Q Consensus        32 l~dlD~etq~~veKmm~dq~qK~~G~ptsde~k~~e   67 (87)
                      .-+|-.+.|..|..+||.+|+..+...-+.-....+
T Consensus        55 ~l~lT~~Qrqqi~~i~~~~~~a~~~~~~~~r~~l~~   90 (160)
T COG3678          55 GLDLTRAQRQQIRDLMQAQRRAQREQLRSKRRALHE   90 (160)
T ss_pred             cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445677899999999999997665544444333333


No 10 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=45.39  E-value=22  Score=21.83  Aligned_cols=24  Identities=17%  Similarity=0.356  Sum_probs=17.5

Q ss_pred             cccccCCCCCCCCCCCCHHHHHHHHHHH
Q psy16431         20 INTKKINPEPSKLSDLDGETRGLVEKMM   47 (87)
Q Consensus        20 ID~~kI~~~~~~l~dlD~etq~~veKmm   47 (87)
                      .++..|.    .+++|.++-|..|++++
T Consensus        58 ~~~~~i~----G~~~L~~~Dq~~i~~~i   81 (82)
T PF00645_consen   58 GDIEEIK----GFDELKPEDQEKIRKLI   81 (82)
T ss_dssp             SCGGGCE----TCCCS-HHHHHHHHHHH
T ss_pred             CCHHHCC----ChHHCCHHHHHHHHHHh
Confidence            4455554    69999999999998764


No 11 
>PHA00159 endonuclease I
Probab=41.44  E-value=30  Score=25.01  Aligned_cols=26  Identities=50%  Similarity=0.777  Sum_probs=18.9

Q ss_pred             CCCCcHHHHHHHHHHHHHHhCCCCC----CCCC
Q psy16431         56 GLPTSDEQKKQDVLKKFMEQHPEMD----FSNC   84 (87)
Q Consensus        56 G~ptsde~k~~e~Lkkf~~~~p~~d----fs~~   84 (87)
                      |.=.+|+.+|+.+.+   +|||++|    ||+.
T Consensus        68 G~w~~ddR~K~lli~---eQ~P~ldiR~VFs~s   97 (148)
T PHA00159         68 GLWDSDDRKKHLLIR---EQYPELDIRFVFSSS   97 (148)
T ss_pred             ccCChHHHHHHHHHH---HHCCCccEEEEEecC
Confidence            555677777776655   6999999    6654


No 12 
>PF10929 DUF2811:  Protein of unknown function (DUF2811);  InterPro: IPR021231  This is a bacterial family of uncharacterised proteins. 
Probab=41.05  E-value=24  Score=21.72  Aligned_cols=15  Identities=40%  Similarity=0.888  Sum_probs=13.1

Q ss_pred             HHHHHHHHHhCCCCC
Q psy16431         66 QDVLKKFMEQHPEMD   80 (87)
Q Consensus        66 ~e~Lkkf~~~~p~~d   80 (87)
                      ++-|++|.+.||+.|
T Consensus        11 ~~~m~~fie~hP~WD   25 (57)
T PF10929_consen   11 HQAMKDFIETHPNWD   25 (57)
T ss_pred             HHHHHHHHHcCCCch
Confidence            556899999999988


No 13 
>PF12585 DUF3759:  Protein of unknown function (DUF3759);  InterPro: IPR022234  This family of proteins is found in eukaryotes. Proteins in this family are typically between 107 and 132 amino acids in length. There is a single completely conserved residue H that may be functionally important. 
Probab=40.62  E-value=41  Score=22.57  Aligned_cols=25  Identities=32%  Similarity=0.582  Sum_probs=20.1

Q ss_pred             HHHHHHHHcCCCCcHHHHHHHHHHHH
Q psy16431         47 MYDQRQKEMGLPTSDEQKKQDVLKKF   72 (87)
Q Consensus        47 m~dq~qK~~G~ptsde~k~~e~Lkkf   72 (87)
                      +|+.+|+.-|+|.|...-|+ +|--|
T Consensus        31 ayEdhq~~~Gkp~sHa~AKE-llAg~   55 (93)
T PF12585_consen   31 AYEDHQRKNGKPVSHAFAKE-LLAGF   55 (93)
T ss_pred             HHHHHHHHcCCCCcHHHHHH-HHHHH
Confidence            59999999999999987775 44433


No 14 
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif.
Probab=31.87  E-value=1.1e+02  Score=18.05  Aligned_cols=19  Identities=11%  Similarity=0.303  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHhCCCCCCC
Q psy16431         64 KKQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        64 k~~e~Lkkf~~~~p~~dfs   82 (87)
                      .-....+++..+||++-|+
T Consensus        54 ~a~~~k~~y~~~~p~y~y~   72 (72)
T cd01388          54 EAKKLKELHMKLYPDYKWR   72 (72)
T ss_pred             HHHHHHHHHHHHCcCCCCC
Confidence            4455678899999998664


No 15 
>PF05367 Phage_endo_I:  Phage endonuclease I;  InterPro: IPR008029 Endonuclease I (3.1.21.2 from EC) is a junction-resolving enzyme encoded by bacteriophage T7, that selectively binds and cleaves four-way Holliday DNA junctions []. The structure of the enzyme shows that it forms a symmetric homodimer arranged in two well-separated domains. Each domain, however, is composed of elements from both subunits, and amino acid side chains from both protomers contribute to the active site []. ; GO: 0008833 deoxyribonuclease IV (phage-T4-induced) activity, 0015074 DNA integration, 0016032 viral reproduction; PDB: 3CAE_A 1M0D_A 1M0I_C 1FZR_B 2PFJ_B.
Probab=31.80  E-value=39  Score=24.47  Aligned_cols=22  Identities=36%  Similarity=0.641  Sum_probs=14.6

Q ss_pred             CCCCcHHHHHHHHHHHHHHhCCCCC
Q psy16431         56 GLPTSDEQKKQDVLKKFMEQHPEMD   80 (87)
Q Consensus        56 G~ptsde~k~~e~Lkkf~~~~p~~d   80 (87)
                      |.=.+++.+|+.+++   ++||++|
T Consensus        68 G~f~~~DR~K~l~Ik---~q~P~LD   89 (149)
T PF05367_consen   68 GRFDAEDRRKHLLIK---EQYPELD   89 (149)
T ss_dssp             SS--HHHHHHHHHHH---HH-TTSE
T ss_pred             eccCcchhHHHHHHH---HhCCCcc
Confidence            445567888887666   5999999


No 16 
>PF08863 YolD:  YolD-like protein;  InterPro: IPR014962 These proteins are functionally uncharacterised. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from Gram-negative bacteria []. 
Probab=31.79  E-value=98  Score=18.83  Aligned_cols=37  Identities=22%  Similarity=0.364  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHHHh
Q psy16431         37 GETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFMEQ   75 (87)
Q Consensus        37 ~etq~~veKmm~dq~qK~~G~ptsde~k~~e~Lkkf~~~   75 (87)
                      ||.+.++.++.-++...  -+|.-++.+..++...+..+
T Consensus         2 PEH~e~L~~~~~e~~k~--~kp~Lde~~leei~~~l~~a   38 (92)
T PF08863_consen    2 PEHKEALRELIKEQNKV--EKPELDEQQLEEINEKLSEA   38 (92)
T ss_pred             ChHHHHHHHHHHHhccc--CCCCCcHHHHHHHHHHHHHH
Confidence            35667777766554443  37788888888888777654


No 17 
>PF08897 DUF1841:  Domain of unknown function (DUF1841);  InterPro: IPR014993 This group of proteins are functionally uncharacterised. 
Probab=30.88  E-value=1.3e+02  Score=21.33  Aligned_cols=39  Identities=26%  Similarity=0.477  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHHHHHc-CCCCcHHHHHHHHHHHHHHhCCCCC
Q psy16431         39 TRGLVEKMMYDQRQKEM-GLPTSDEQKKQDVLKKFMEQHPEMD   80 (87)
Q Consensus        39 tq~~veKmm~dq~qK~~-G~ptsde~k~~e~Lkkf~~~~p~~d   80 (87)
                      +|..|+++.+|--+|.. |.|-+.-..   +.-....+|||+.
T Consensus         2 sr~~~R~ff~~~w~K~~~~~~L~~lE~---~a~~~i~~HPEYh   41 (137)
T PF08897_consen    2 SRDQVRRFFCDAWRKYRAGEPLTPLEQ---IAADVIEEHPEYH   41 (137)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCHHHH---HHHHHHHHCcchH
Confidence            46789999999888755 666654333   2356677999963


No 18 
>PRK13676 hypothetical protein; Provisional
Probab=29.67  E-value=1.6e+02  Score=19.20  Aligned_cols=44  Identities=27%  Similarity=0.360  Sum_probs=26.9

Q ss_pred             CHHHHHHHHHHHH---HHHHH-HcCC-CCcHHHHHHHHHHHHHHhCCCC
Q psy16431         36 DGETRGLVEKMMY---DQRQK-EMGL-PTSDEQKKQDVLKKFMEQHPEM   79 (87)
Q Consensus        36 D~etq~~veKmm~---dq~qK-~~G~-ptsde~k~~e~Lkkf~~~~p~~   79 (87)
                      |++++..|....-   ...++ ..|. ++.++.+...-|.+-...||.+
T Consensus        35 d~~a~~li~~F~~~q~~~~~~q~~g~~~~~e~~~~l~~l~~~i~~n~~i   83 (114)
T PRK13676         35 DEEAKKLFDEFRALQLEIQQKQMTGQEITEEEQQKAQELGQKIQQNELL   83 (114)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHhcCHHH
Confidence            6788888776542   21112 4576 4555666666777766778764


No 19 
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS.   The PWWP domain of histone-lysine N-methyltransferase, also known as Nuclear SET domain-containing protein 3, is also included. Mutations in MSH6 have been linked to increased cancer susceptibility, particularly in hereditary nonpolyposis colorectal cancer in humans.  The role of the PWWP domain in MSH6 is not clear; MSH6 orthologs found in S. cerevisiae, Caenorhabditis elegans and Arabidopsis thaliana lack the PWWP domain.   Histone methyltransferases (HMTases) induce the posttranslational methylation of lysine residues in histones and play a role in apoptosis.  In the HMTase Whistle, the PWWP domain is necessary for HMTase activity. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain pro
Probab=28.59  E-value=29  Score=23.00  Aligned_cols=20  Identities=30%  Similarity=0.855  Sum_probs=16.2

Q ss_pred             ccccccccccccccCCcccc
Q psy16431          2 EKINKMEWWSKLVTTDPEIN   21 (87)
Q Consensus         2 ~K~~~~~WW~~vl~GdpeID   21 (87)
                      .|+..--||+|+|..+|.+.
T Consensus        11 aK~~g~PwWPa~V~~~~~~~   30 (110)
T cd05837          11 AKVSGYPWWPCMVCSDPLLG   30 (110)
T ss_pred             EeCCCCCCCCEEEecccccc
Confidence            36666689999999998775


No 20 
>cd08470 PBP2_CrgA_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene
Probab=28.42  E-value=33  Score=21.90  Aligned_cols=18  Identities=17%  Similarity=0.540  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|.+|.++||+.+++
T Consensus        16 l~~~l~~f~~~~P~v~l~   33 (197)
T cd08470          16 IAPLVNDFMQRYPKLEVD   33 (197)
T ss_pred             HHHHHHHHHHHCCCeEEE
Confidence            356889999999998764


No 21 
>PF11590 DNAPolymera_Pol:  DNA polymerase catalytic subunit Pol;  InterPro: IPR021639  This family of proteins represents the catalytic subunit, Pol, of the Herpes simplex virus DNA polymerase. Pol binds UL42, making up the DNA polymerase. UL42 is a processivity subunit which binds to the C-terminal of Pol in a similar way that the cell cycle regulator p21 binds to PCNA []. ; GO: 0003887 DNA-directed DNA polymerase activity, 0004523 ribonuclease H activity; PDB: 1DML_H.
Probab=28.20  E-value=55  Score=18.94  Aligned_cols=32  Identities=19%  Similarity=0.357  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHH
Q psy16431         41 GLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKF   72 (87)
Q Consensus        41 ~~veKmm~dq~qK~~G~ptsde~k~~e~Lkkf   72 (87)
                      ..+..-+|..-.---|+|.++|.+.+-.|.+.
T Consensus         5 ~Rl~~AgF~~i~~g~g~~~~~eeEt~qkL~~A   36 (41)
T PF11590_consen    5 ERLRSAGFATIGSGAGLPSSEEEETRQKLRRA   36 (41)
T ss_dssp             HHHHHTT-EEECTTS------HHHHHHHHHHH
T ss_pred             HHHHHHhHHHhccCccccchhhHHHHHHHHHH
Confidence            33333444433344588999999999888764


No 22 
>PF13801 Metal_resist:  Heavy-metal resistance; PDB: 3EPV_C 2Y3D_A 2Y3H_D 2Y3G_B 2Y3B_A 2Y39_A 3LAY_H.
Probab=27.70  E-value=1.5e+02  Score=18.07  Aligned_cols=42  Identities=24%  Similarity=0.356  Sum_probs=27.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHH-----------------HHcCCCCcHHHHHHHHHHHHHH
Q psy16431         33 SDLDGETRGLVEKMMYDQRQ-----------------KEMGLPTSDEQKKQDVLKKFME   74 (87)
Q Consensus        33 ~dlD~etq~~veKmm~dq~q-----------------K~~G~ptsde~k~~e~Lkkf~~   74 (87)
                      .+|+++.+..|+.++-+.+.                 ..+..|+.|+.+...++++..+
T Consensus        40 l~Lt~eQ~~~l~~~~~~~~~~~~~~r~~~~~~r~~l~~ll~~~~~D~~~i~a~~~~~~~   98 (125)
T PF13801_consen   40 LNLTPEQQAKLRALMDEFRQEMRALRQELRAARQELRALLAAPPPDEAAIEALLEEIRE   98 (125)
T ss_dssp             S-TTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSSS-HHHHHHHHHHHHH
T ss_pred             cCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHH
Confidence            46899999999998876554                 2455666666666655555543


No 23 
>PF11637 UvsW:  ATP-dependant DNA helicase UvsW;  InterPro: IPR020975  This entry represents the DNA helicase UvsW from Enterobacteria phage T4. The protein is a member of the monomeric SF2 helicase superfamily and shows structural homology to the eukaryotic SF2 helicase Rad54. UvsW is thought to have a role in recombination and the rescue of stalled replication forks []. ; PDB: 2JPN_A.
Probab=27.13  E-value=56  Score=19.94  Aligned_cols=24  Identities=38%  Similarity=0.589  Sum_probs=20.3

Q ss_pred             HHHHHHHHcCCCCcHHHHHHHHHH
Q psy16431         47 MYDQRQKEMGLPTSDEQKKQDVLK   70 (87)
Q Consensus        47 m~dq~qK~~G~ptsde~k~~e~Lk   70 (87)
                      .|.+|-|...+..|+++..++.|.
T Consensus        16 yY~kR~KEv~l~~sdDIsiRDAl~   39 (54)
T PF11637_consen   16 YYKKRKKEVELKDSDDISIRDALA   39 (54)
T ss_dssp             HHHHHTTTS--TTHHHHHHHHHHH
T ss_pred             HHHHhhhhcccCCcccccHHHHhc
Confidence            599999999999999999999984


No 24 
>KOG4260|consensus
Probab=26.92  E-value=53  Score=26.56  Aligned_cols=32  Identities=22%  Similarity=0.451  Sum_probs=26.3

Q ss_pred             HHHHcCCCCcHHHHHHHHHHHHHH--hCCCCCCC
Q psy16431         51 RQKEMGLPTSDEQKKQDVLKKFME--QHPEMDFS   82 (87)
Q Consensus        51 ~qK~~G~ptsde~k~~e~Lkkf~~--~~p~~dfs   82 (87)
                      ..|.+++..+-|.+-.|+|+.+=.  .-|+|||-
T Consensus        60 EEknL~kYk~SE~RLvEilEglCsks~~~n~Dfe   93 (350)
T KOG4260|consen   60 EEKNLSKYKTSETRLVEILEGLCSKSSLPNMDFE   93 (350)
T ss_pred             hhhhhhhccccchhHHHHHHHhhhccCCCCCChH
Confidence            346778888889999999999876  56999984


No 25 
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=26.04  E-value=1.4e+02  Score=19.07  Aligned_cols=35  Identities=26%  Similarity=0.134  Sum_probs=29.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHcCCCCcHHHHHH
Q psy16431         32 LSDLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQ   66 (87)
Q Consensus        32 l~dlD~etq~~veKmm~dq~qK~~G~ptsde~k~~   66 (87)
                      =.-++++.-..+.+++++...+..|+.++.+++..
T Consensus        39 e~~~~~e~~~~~~~~i~~~~~~~~~~~~~~~i~~~   73 (127)
T TIGR03830        39 EELLDPEESKRNSAALADFYRKVDGLLTPPEIRRI   73 (127)
T ss_pred             CEEEcHHHHHHHHHHHHHHHHHccCCcCHHHHHHH
Confidence            34467788899999999999999999999887654


No 26 
>PF08947 BPS:  BPS (Between PH and SH2) ;  InterPro: IPR015042 The BPS (Between PH and SH2) domain, comprised of 2 beta strands and a C-terminal helix, is an approximately 45 residue region found in the adaptor proteins Grb7/10/14 that mediates inhibition of the tyrosine kinase domain of the insulin receptor by binding of the N-terminal portion of the BPS domain to the substrate peptide groove of the kinase, acting as a pseudosubstrate inhibitor []. ; PDB: 2AUH_B.
Probab=25.35  E-value=21  Score=21.42  Aligned_cols=8  Identities=50%  Similarity=0.679  Sum_probs=5.2

Q ss_pred             CCCCCCCC
Q psy16431         78 EMDFSNCK   85 (87)
Q Consensus        78 ~~dfs~~~   85 (87)
                      -||||+..
T Consensus        10 aMDFsG~~   17 (49)
T PF08947_consen   10 AMDFSGQT   17 (49)
T ss_dssp             EEE-SSSS
T ss_pred             EeeecCCc
Confidence            48999864


No 27 
>cd08477 PBP2_CrgA_like_8 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 8. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=24.82  E-value=46  Score=21.13  Aligned_cols=17  Identities=12%  Similarity=0.464  Sum_probs=14.1

Q ss_pred             HHHHHHHHHhCCCCCCC
Q psy16431         66 QDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        66 ~e~Lkkf~~~~p~~dfs   82 (87)
                      -.+|..|.++||++.|+
T Consensus        17 ~~~l~~~~~~~P~i~l~   33 (197)
T cd08477          17 TPALAEYLARYPDVRVD   33 (197)
T ss_pred             HHHHHHHHHHCCCcEEE
Confidence            46789999999998764


No 28 
>cd08486 PBP2_CbnR The C-terminal substrate binding domain of LysR-type transcriptional regulator, CbnR, involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of LysR-type regulator CbnR which is involved in the regulation of chlorocatechol breakdown. The chlorocatechol-degradative pathway is often found in bacteria that can use chlorinated aromatic compounds as carbon and energy sources. CbnR is found in the 3-chlorobenzoate degradative bacterium Ralstonia eutropha NH9 and forms a tetramer. CbnR activates the expression of the cbnABCD genes, which are responsible for the degradation of chlorocatechol converted from 3-chlorobenzoate and are transcribed divergently from cbnR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccha
Probab=24.23  E-value=42  Score=21.91  Aligned_cols=18  Identities=22%  Similarity=0.381  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|++|..+||++.++
T Consensus        16 l~~~l~~f~~~~P~v~i~   33 (198)
T cd08486          16 LPLLLRAFLTSTPTATVS   33 (198)
T ss_pred             HHHHHHHHHHhCCCeEEE
Confidence            347889999999998764


No 29 
>PRK13798 putative OHCU decarboxylase; Provisional
Probab=23.90  E-value=87  Score=22.39  Aligned_cols=48  Identities=15%  Similarity=0.163  Sum_probs=34.7

Q ss_pred             ccccccCCccccccc----CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHcCCC
Q psy16431         10 WSKLVTTDPEINTKK----INPEPSKLSDLDGETRGLVEKMMYDQRQKEMGLP   58 (87)
Q Consensus        10 W~~vl~GdpeID~~k----I~~~~~~l~dlD~etq~~veKmm~dq~qK~~G~p   58 (87)
                      |..+|.+||.|--..    -..+.+.|+.|++++...+..+=-.++.|= |.|
T Consensus        64 ~~~~l~~HP~lg~~~~~~~S~~EQ~gl~~l~~~~~~~l~~lN~~Y~~kF-Gfp  115 (166)
T PRK13798         64 IDEALAGHPRIGERPASKASAREQAGVADADEAVMAALAAGNRAYEEKF-GFV  115 (166)
T ss_pred             HHHHHHhCCcccCccccccCHHHhcccccCCHHHHHHHHHHHHHHHHhC-CCe
Confidence            567889999987533    223456788999999999888877777764 544


No 30 
>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of  leucine synthesis operon, contains the type 2 periplasmic binding fold. LeuO, a LysR-type transcriptional regulator, was originally identified as an activator of the leucine synthesis operon (leuABCD). Subsequently, LeuO was found to be not a specific regulator of the leu gene but a global regulator of unrelated various genes. LeuO activates bglGFB (utilization of beta-D-glucoside) and represses cadCBA (lysine decarboxylation) and dsrA (encoding a regulatory small RNA for translational control of rpoS and hns). LeuO also regulates the yjjQ-bglJ operon which coding for a LuxR-type transcription factor. In Salmonella enterica serovar Typhi, LeuO is a positive regulator of ompS1 (encoding an outer membrane), ompS2 (encoding a pathogenicity determinant), and assT, while LeuO represses the expression of OmpX and Tpx. Both osmS1 and osmS2 influence virulence in the mouse mo
Probab=23.64  E-value=50  Score=21.10  Aligned_cols=18  Identities=11%  Similarity=0.348  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|..|..+||++.++
T Consensus        15 l~~~l~~f~~~~P~v~l~   32 (200)
T cd08466          15 LPRLLARLKQLAPNISLR   32 (200)
T ss_pred             HHHHHHHHHHHCCCCEEE
Confidence            356889999999998753


No 31 
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of CidR which positively up-regulates the expression of cidABC operon in the presence of acetic acid produced by the metabolism of excess glucose. The CidR affects the control of murein hydrolase activity by enhancing cidABC expression in the presence of acetic acid. Thus, up-regulation of cidABC expression results in increased murein hydrolase activity. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate 
Probab=23.50  E-value=45  Score=21.00  Aligned_cols=18  Identities=17%  Similarity=0.427  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      -..+|.+|.++||+..++
T Consensus        15 l~~~l~~~~~~~p~v~i~   32 (197)
T cd08438          15 FAPLLAAFRQRYPNIELE   32 (197)
T ss_pred             cHHHHHHHHHHCcCeEEE
Confidence            356889999999998764


No 32 
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS).  When translocated, WHSC1 plays a role in lymphoid multiple myeloma (MM) disease, also known as plasmacytoma. WHCS1 proteins typically contain two copies of the PWWP domain.  The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=23.10  E-value=39  Score=21.86  Aligned_cols=20  Identities=20%  Similarity=0.787  Sum_probs=15.4

Q ss_pred             ccccccccccccccCCcccc
Q psy16431          2 EKINKMEWWSKLVTTDPEIN   21 (87)
Q Consensus         2 ~K~~~~~WW~~vl~GdpeID   21 (87)
                      .|+..-.||+++|...+++.
T Consensus         9 aK~~g~pwWPa~V~~~~~~p   28 (95)
T cd05838           9 AKLGNFRWWPAIICDPREVP   28 (95)
T ss_pred             EECCCCCCCCeEEcChhhcC
Confidence            36666789999999876654


No 33 
>cd08476 PBP2_CrgA_like_7 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 7. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=22.99  E-value=46  Score=20.97  Aligned_cols=17  Identities=35%  Similarity=0.696  Sum_probs=14.2

Q ss_pred             HHHHHHHHHhCCCCCCC
Q psy16431         66 QDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        66 ~e~Lkkf~~~~p~~dfs   82 (87)
                      ..+|.+|..+||+.+++
T Consensus        15 ~~~l~~~~~~~P~v~i~   31 (197)
T cd08476          15 LPVLAAFMQRYPEIELD   31 (197)
T ss_pred             HHHHHHHHHHCCCeEEE
Confidence            45899999999998764


No 34 
>PF08909 DUF1854:  Domain of unknown function (DUF1854);  InterPro: IPR015005 These protein is functionally uncharacterised. It is found at the C terminus of a number of ATP transporter proteins suggesting it may be involved in ligand binding. 
Probab=22.97  E-value=55  Score=23.05  Aligned_cols=16  Identities=44%  Similarity=0.648  Sum_probs=14.0

Q ss_pred             CCCCCCHHHHHHHHHH
Q psy16431         31 KLSDLDGETRGLVEKM   46 (87)
Q Consensus        31 ~l~dlD~etq~~veKm   46 (87)
                      .|++||+++|+.|+.-
T Consensus        36 ~l~~L~~~~r~lle~e   51 (133)
T PF08909_consen   36 DLDDLPEESRALLEEE   51 (133)
T ss_pred             ChhHCCHHHHHHHHHH
Confidence            5999999999999763


No 35 
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold. TdcA, a member of the LysR family, activates the expression of the anaerobically-regulated tdcABCDEFG operon which is involved in the degradation of L-serine and L-threonine to acetate and propionate, respectively. The tdc operon is comprised of one regulatory gene tdcA and six structural genes, tdcB to tdcG. The expression of the tdc operon is affected by several transcription factors including the cAMP receptor protein (CRP), integration host factor (IHF), histone-like protein (HU), and the operon specific regulators TdcA and TcdR. TcdR is divergently transcribed from the operon and encodes a small protein that is required for efficient expression of the Escherichia coli tdc operon.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding
Probab=22.17  E-value=55  Score=20.75  Aligned_cols=18  Identities=33%  Similarity=0.659  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      -..+|..|.+.||+..|+
T Consensus        15 l~~~l~~~~~~~P~i~l~   32 (201)
T cd08418          15 MPAVINRFKEQFPDVQIS   32 (201)
T ss_pred             hHHHHHHHHHHCCCceEE
Confidence            346789999999998764


No 36 
>cd08422 PBP2_CrgA_like The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own 
Probab=22.08  E-value=46  Score=20.89  Aligned_cols=18  Identities=17%  Similarity=0.492  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|..|.++||+.+++
T Consensus        16 l~~~l~~~~~~~P~v~i~   33 (197)
T cd08422          16 LAPLLAEFLARYPDVRLE   33 (197)
T ss_pred             HHHHHHHHHHhCCceEEE
Confidence            456889999999997763


No 37 
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold and has been shown to be localized to the periplasm. Unlike the related protein TrbB (TIGR02738), TraF does not contain a conserved pair of cysteines and has been shown not to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. Even more closely related than TrbB is a clade of genes (TIGR02740) which do contain the CXXC motif, but it is unclear whether these genes are involved in type-F conjugation systems per se.
Probab=21.51  E-value=3.7e+02  Score=20.62  Aligned_cols=49  Identities=20%  Similarity=0.331  Sum_probs=36.7

Q ss_pred             CCH-HHHHHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHH---------------HhCCCCCCCC
Q psy16431         35 LDG-ETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFM---------------EQHPEMDFSN   83 (87)
Q Consensus        35 lD~-etq~~veKmm~dq~qK~~G~ptsde~k~~e~Lkkf~---------------~~~p~~dfs~   83 (87)
                      ++. +.-+.+++.+=+-+-++.--||.+..+.-..|.+++               -+||++|++.
T Consensus        57 ~~~~~~~~~l~~~~~~~~~~Ai~~Pt~ENv~~y~~lq~~~~dka~~Fa~~~~~v~l~~PeLdy~l  121 (256)
T TIGR02739        57 LSPTEQMKLLRQETKEALNQAILNPSVENFARYMRLQRFWTKQSSQFSMTWQKALLAHPELDYTL  121 (256)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCccc
Confidence            444 555667777778888899999999888776666654               4689999864


No 38 
>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse funct
Probab=21.42  E-value=58  Score=20.35  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      -..+|.+|.++||+..+.
T Consensus        15 l~~~l~~~~~~~p~v~i~   32 (197)
T cd08440          15 LPPVLAAFRRRHPGIRVR   32 (197)
T ss_pred             HHHHHHHHHHhCCCcEEE
Confidence            457889999999998753


No 39 
>cd08452 PBP2_AlsR The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate.  Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 perip
Probab=21.32  E-value=57  Score=21.03  Aligned_cols=18  Identities=6%  Similarity=0.409  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|..|..+||+.+++
T Consensus        15 l~~~l~~~~~~~P~v~i~   32 (197)
T cd08452          15 LPPIVREYRKKFPSVKVE   32 (197)
T ss_pred             HHHHHHHHHHHCCCcEEE
Confidence            357899999999998764


No 40 
>cd08450 PBP2_HcaR The C-terminal substrate binding domain of LysR-type transcriptional regulator HcaR in involved in 3-phenylpropionic acid catabolism, contains the type2 periplasmic binding fold. HcaR, a member of the LysR family of transcriptional regulators, controls the expression of the hcA1, A2, B, C, and D operon, encoding for the 3-phenylpropionate dioxygenase complex and 3-phenylpropionate-2',3'-dihydrodiol dehydrogenase, that oxidizes 3-phenylpropionate to 3-(2,3-dihydroxyphenyl) propionate.  Dioxygenases play an important role in protecting the cell against the toxic effects of dioxygen. The expression of hcaR is negatively auto-regulated, as for other members of the LysR family, and is strongly repressed in the presence of glucose. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=21.30  E-value=55  Score=20.74  Aligned_cols=18  Identities=33%  Similarity=0.645  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|+.|..+||++.++
T Consensus        15 l~~~l~~~~~~~P~i~l~   32 (196)
T cd08450          15 LPEVLPILREEHPDLDVE   32 (196)
T ss_pred             HHHHHHHHHhhCCCcEEE
Confidence            356889999999998653


No 41 
>cd08464 PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=21.26  E-value=58  Score=20.68  Aligned_cols=18  Identities=11%  Similarity=0.261  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|..|...||+.++.
T Consensus        15 l~~~l~~~~~~~P~v~l~   32 (200)
T cd08464          15 APPLLAALRAEAPGVRLV   32 (200)
T ss_pred             HHHHHHHHHHHCCCcEEE
Confidence            456789999999997753


No 42 
>cd08471 PBP2_CrgA_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 2. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=21.25  E-value=59  Score=20.69  Aligned_cols=18  Identities=17%  Similarity=0.479  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|.+|.+.||+.+++
T Consensus        16 l~~~l~~~~~~~P~v~i~   33 (201)
T cd08471          16 VLPIITDFLDAYPEVSVR   33 (201)
T ss_pred             HHHHHHHHHHHCCCcEEE
Confidence            346889999999987764


No 43 
>cd08472 PBP2_CrgA_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=20.76  E-value=61  Score=20.63  Aligned_cols=18  Identities=17%  Similarity=0.490  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|.+|.++||++.++
T Consensus        16 l~~~l~~~~~~~P~i~v~   33 (202)
T cd08472          16 LIPALPDFLARYPDIELD   33 (202)
T ss_pred             HHHHHHHHHHHCCCcEEE
Confidence            346889999999998764


No 44 
>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefa
Probab=20.67  E-value=61  Score=20.43  Aligned_cols=17  Identities=24%  Similarity=0.634  Sum_probs=13.8

Q ss_pred             HHHHHHHHHhCCCCCCC
Q psy16431         66 QDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        66 ~e~Lkkf~~~~p~~dfs   82 (87)
                      ..+|.+|.++||+.+++
T Consensus        16 ~~~l~~~~~~~P~i~l~   32 (196)
T cd08415          16 PRAIARFRARHPDVRIS   32 (196)
T ss_pred             HHHHHHHHHHCCCcEEE
Confidence            46889999999997753


No 45 
>PF12995 DUF3879:  Domain of unknown function, E. rectale Gene description (DUF3879);  InterPro: IPR024540 This entry represents proteins of unknown function found primarily in Firmicutes. The Eubacterium rectale gene appears to be upregulated in the presence of Bacteroides thetaiotaomicron compared to growth in pure culture [].
Probab=20.47  E-value=3.8e+02  Score=20.08  Aligned_cols=68  Identities=16%  Similarity=0.285  Sum_probs=52.9

Q ss_pred             ccccccCCcccccccCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHHHhCC
Q psy16431         10 WSKLVTTDPEINTKKINP-EPSKLSDLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFMEQHP   77 (87)
Q Consensus        10 W~~vl~GdpeID~~kI~~-~~~~l~dlD~etq~~veKmm~dq~qK~~G~ptsde~k~~e~Lkkf~~~~p   77 (87)
                      |-....|..-+|++--.+ ...+|--.+++.+..|..+.+...-+.-|....|..+..++.+....+-|
T Consensus        58 ~~np~~g~aGldVTg~~~~s~~rIi~VsE~~~q~mfdlvkkef~~enG~snGDttkrs~i~k~y~~sv~  126 (186)
T PF12995_consen   58 WINPNNGLAGLDVTGKNCASWQRIIPVSEEVRQKMFDLVKKEFKNENGVSNGDTTKRSDIIKDYYMSVP  126 (186)
T ss_pred             ccCCCCCcccccccCCCccchhheecCCHHHHHHHHHHHHHHHHHhcCCCCCCcchHHHHHHHHHHhcC
Confidence            333445666677766653 33467778899999999999999999999999999999999998876555


No 46 
>cd08474 PBP2_CrgA_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=20.43  E-value=55  Score=20.92  Aligned_cols=18  Identities=17%  Similarity=0.536  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.+|.+|.+.||+.+++
T Consensus        18 l~~~l~~~~~~~P~v~i~   35 (202)
T cd08474          18 LAPLLARFLARYPDIRLE   35 (202)
T ss_pred             HHHHHHHHHHHCCCeEEE
Confidence            447899999999997753


No 47 
>cd08481 PBP2_GcdR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators GcdR-like, contains the type 2 periplasmic binding fold. GcdR is involved in the glutaconate/glutarate-specific activation of the Pg promoter driving expression of a glutaryl-CoA dehydrogenase-encoding gene (gcdH). The GcdH protein is essential for the anaerobic catabolism of many aromatic compounds and some alicyclic and dicarboxylic acids.  The structural topology of this substrate-binding domain is most similar to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplas
Probab=20.31  E-value=54  Score=20.64  Aligned_cols=17  Identities=24%  Similarity=0.597  Sum_probs=13.8

Q ss_pred             HHHHHHHHHhCCCCCCC
Q psy16431         66 QDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        66 ~e~Lkkf~~~~p~~dfs   82 (87)
                      -.+|.+|...||++.++
T Consensus        16 ~~~l~~f~~~~P~i~i~   32 (194)
T cd08481          16 IPRLPDFLARHPDITVN   32 (194)
T ss_pred             HhhhhHHHHHCCCceEE
Confidence            45789999999997764


No 48 
>PF15060 PPDFL:  Differentiation and proliferation regulator
Probab=20.25  E-value=54  Score=22.64  Aligned_cols=19  Identities=16%  Similarity=0.569  Sum_probs=15.3

Q ss_pred             CccccccccccccccCCcc
Q psy16431          1 MEKINKMEWWSKLVTTDPE   19 (87)
Q Consensus         1 L~K~~~~~WW~~vl~Gdpe   19 (87)
                      |-|+..+.||.+.|-|.+.
T Consensus        46 Lpkad~g~WW~sfFF~k~~   64 (110)
T PF15060_consen   46 LPKADPGHWWASFFFGKST   64 (110)
T ss_pred             ccccCCCcceEEeEecccc
Confidence            4577888999999988853


No 49 
>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=20.21  E-value=63  Score=21.30  Aligned_cols=19  Identities=11%  Similarity=0.310  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHhCCCCCCC
Q psy16431         64 KKQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        64 k~~e~Lkkf~~~~p~~dfs   82 (87)
                      ---.+|.+|...||++++.
T Consensus        14 ~~~~~l~~~~~~~P~~~v~   32 (203)
T cd08463          14 FLPELVARFRREAPGARLE   32 (203)
T ss_pred             HhHHHHHHHHHHCCCCEEE
Confidence            3456899999999998763


No 50 
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrate
Probab=20.19  E-value=57  Score=20.72  Aligned_cols=18  Identities=11%  Similarity=0.333  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy16431         65 KQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        65 ~~e~Lkkf~~~~p~~dfs   82 (87)
                      --.++.+|...||+.+|+
T Consensus        15 ~~~~i~~~~~~~P~i~l~   32 (200)
T cd08417          15 LPPLLARLRQEAPGVRLR   32 (200)
T ss_pred             HHHHHHHHHhhCCCeEEE
Confidence            456789999999997764


No 51 
>PF07055 Eno-Rase_FAD_bd:  Enoyl reductase FAD binding domain;  InterPro: IPR010758 This family contains a number of bacterial putative reductases. ; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3S8M_A 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A.
Probab=20.18  E-value=1.1e+02  Score=19.21  Aligned_cols=33  Identities=12%  Similarity=0.180  Sum_probs=19.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHHH
Q psy16431         34 DLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFME   74 (87)
Q Consensus        34 dlD~etq~~veKmm~dq~qK~~G~ptsde~k~~e~Lkkf~~   74 (87)
                      +|++++|+.|.+++        ..-|++.....-=++-|+.
T Consensus        14 El~~dvQ~~V~~lw--------~~it~en~~el~D~~gy~~   46 (65)
T PF07055_consen   14 ELRPDVQAEVAELW--------EQITTENFKELGDYDGYRQ   46 (65)
T ss_dssp             CCSHHHHHHHHHHH--------CCT-CCCHHHHS-HHHHHH
T ss_pred             hcCHHHHHHHHHHH--------HHhccccHHHHHhHHHHHH
Confidence            67999999997754        4555665554443444333


No 52 
>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold. Galactose-binding protein regulator (GbpR), a member of the LysR family of bacterial transcriptional regulators, regulates the expression of chromosomal virulence gene chvE.   The chvE gene is involved in the uptake of specific sugars, in chemotaxis to these sugars, and in the VirA-VirG two-component signal transduction system. In the presence of an inducing sugar such as L-arabinose, D-fucose, or D-galactose, GbpR activates chvE expression, while in the absence of an inducing sugar, GbpR represses expression. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a ma
Probab=20.18  E-value=58  Score=20.58  Aligned_cols=19  Identities=11%  Similarity=0.406  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHhCCCCCCC
Q psy16431         64 KKQDVLKKFMEQHPEMDFS   82 (87)
Q Consensus        64 k~~e~Lkkf~~~~p~~dfs   82 (87)
                      --..+|..|..+||+..++
T Consensus        14 ~l~~~l~~~~~~~P~v~i~   32 (201)
T cd08435          14 LLPPAIARLLARHPRLTVR   32 (201)
T ss_pred             HHHHHHHHHHHHCCCeEEE
Confidence            3467899999999987654


No 53 
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substra
Probab=20.02  E-value=62  Score=20.48  Aligned_cols=16  Identities=19%  Similarity=0.688  Sum_probs=13.2

Q ss_pred             HHHHHHHHHhCCCCCC
Q psy16431         66 QDVLKKFMEQHPEMDF   81 (87)
Q Consensus        66 ~e~Lkkf~~~~p~~df   81 (87)
                      -.+|.+|...||+.++
T Consensus        17 ~~~l~~~~~~~P~i~l   32 (199)
T cd08451          17 PGLIRRFREAYPDVEL   32 (199)
T ss_pred             HHHHHHHHHHCCCcEE
Confidence            4578999999998764


Done!