Query psy16436
Match_columns 94
No_of_seqs 32 out of 34
Neff 1.8
Searched_HMMs 46136
Date Fri Aug 16 21:14:35 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy16436.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16436hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF15613 WHIM2: WSTF, HB1, Itc 97.9 1.2E-05 2.5E-10 47.8 3.3 17 14-30 1-17 (38)
2 KOG1472|consensus 90.2 0.031 6.6E-07 49.7 -2.7 45 4-50 10-54 (720)
3 PF14298 DUF4374: Domain of un 77.6 2.7 5.9E-05 35.6 3.3 40 5-44 40-80 (435)
4 KOG1473|consensus 76.8 1.8 3.9E-05 41.6 2.3 30 9-39 406-435 (1414)
5 COG5397 Uncharacterized conser 76.4 1.7 3.7E-05 36.5 1.8 19 11-31 31-49 (349)
6 PF05071 NDUFA12: NADH ubiquin 54.5 7.5 0.00016 26.2 1.3 14 18-31 4-17 (105)
7 KOG1245|consensus 47.7 7.9 0.00017 36.9 0.7 30 10-39 819-850 (1404)
8 PF01820 Dala_Dala_lig_N: D-al 44.6 18 0.00039 24.1 1.9 27 3-31 23-49 (117)
9 PF00568 WH1: WH1 domain; Int 44.5 62 0.0013 21.3 4.4 40 47-86 2-44 (111)
10 PHA00008 J DNA packaging prote 37.7 26 0.00055 20.0 1.5 16 20-35 10-25 (26)
11 cd00772 ProRS_core Prolyl-tRNA 30.9 29 0.00063 26.1 1.3 26 64-89 204-229 (264)
12 PF06970 RepA_N: Replication i 27.5 46 0.00099 21.5 1.6 14 18-31 41-54 (76)
13 KOG3388|consensus 26.7 31 0.00067 25.9 0.8 18 15-32 78-95 (136)
14 PRK14661 acpS 4'-phosphopantet 23.6 22 0.00048 26.8 -0.4 19 66-84 132-161 (169)
15 PF11049 KSHV_K1: Glycoprotein 23.5 44 0.00095 22.8 1.0 16 25-40 12-27 (71)
16 PF13642 DUF4144: protein stru 23.1 24 0.00052 24.3 -0.3 9 78-86 81-89 (101)
17 PF04726 Microvir_J: Microviru 21.9 24 0.00052 19.8 -0.4 16 19-34 8-23 (24)
18 cd08159 APC10-like APC10-like 21.9 63 0.0014 23.0 1.6 15 63-77 85-99 (129)
19 PLN03095 NADH:ubiquinone oxido 21.1 54 0.0012 23.5 1.2 15 16-30 11-25 (115)
20 PF00803 3A: 3A/RNA2 movement 21.1 47 0.001 25.4 0.9 17 45-61 72-88 (234)
No 1
>PF15613 WHIM2: WSTF, HB1, Itc1p, MBD9 motif 2
Probab=97.93 E-value=1.2e-05 Score=47.81 Aligned_cols=17 Identities=53% Similarity=1.253 Sum_probs=16.6
Q ss_pred eeeeceecCCCceEEEE
Q psy16436 14 RLQPLGYDRNQSAFWYF 30 (94)
Q Consensus 14 RvePLG~D~ngs~YWYF 30 (94)
|++|||.|+.++.||+|
T Consensus 1 R~~pLG~DR~~NrYwwf 17 (38)
T PF15613_consen 1 RLKPLGKDRYGNRYWWF 17 (38)
T ss_pred CcccccccCCCceEEEE
Confidence 78999999999999999
No 2
>KOG1472|consensus
Probab=90.23 E-value=0.031 Score=49.68 Aligned_cols=45 Identities=27% Similarity=0.321 Sum_probs=39.5
Q ss_pred hhccCCCCceeeeeceecCCCceEEEEeeeeeeeecCCCCCCCCccc
Q psy16436 4 AVYNLESDSLRLQPLGYDRNQSAFWYFYGTRLYREDYPKVDGEDMLP 50 (94)
Q Consensus 4 ~lk~LdaDsLRvePLG~D~ngs~YWYFyGTRLYrEdp~~~~~~~~l~ 50 (94)
.+++.+.|+++.+||+.+.. .+|||+|||.+.+++......+.+.
T Consensus 10 ~~~~~~~~~~~~~~l~e~~~--l~~~~~~~~~~~l~~vs~~~~~~~~ 54 (720)
T KOG1472|consen 10 LLKPRDDDSLIAEPLNELCS--LCWHFLGTRISHLDNVSGKSNNELL 54 (720)
T ss_pred cCCCchhhhhhcchhhhhhh--hhhhhhhhhhhcccccchhhhhhhH
Confidence 46788999999999999988 9999999999999998887766553
No 3
>PF14298 DUF4374: Domain of unknown function (DUF4374)
Probab=77.61 E-value=2.7 Score=35.64 Aligned_cols=40 Identities=20% Similarity=0.512 Sum_probs=33.1
Q ss_pred hccCCCCceeeeeceecCCCceEEEEeeee-eeeecCCCCC
Q psy16436 5 VYNLESDSLRLQPLGYDRNQSAFWYFYGTR-LYREDYPKVD 44 (94)
Q Consensus 5 lk~LdaDsLRvePLG~D~ngs~YWYFyGTR-LYrEdp~~~~ 44 (94)
..+|+..++-+.-=|....|..||||++.+ +|.=.+-++.
T Consensus 40 a~sL~~G~Is~~gNG~e~dg~~~w~f~~~~~~~~l~Y~qGn 80 (435)
T PF14298_consen 40 AESLDEGSISTKGNGLEQDGTYYWYFYKNNYAFGLLYGQGN 80 (435)
T ss_pred ecccCCceEEeecCcEEecceeEEEEcCCcEEEEEEecCCC
Confidence 357888899998899999999999999997 7776665544
No 4
>KOG1473|consensus
Probab=76.81 E-value=1.8 Score=41.56 Aligned_cols=30 Identities=40% Similarity=0.756 Sum_probs=26.0
Q ss_pred CCCceeeeeceecCCCceEEEEeeeeeeeec
Q psy16436 9 ESDSLRLQPLGYDRNQSAFWYFYGTRLYRED 39 (94)
Q Consensus 9 daDsLRvePLG~D~ngs~YWYFyGTRLYrEd 39 (94)
+.|++|-+|+|.|+.|..|| |..-||.-|+
T Consensus 406 ~~~~iR~~~iG~dr~gr~yw-fi~rrl~Ie~ 435 (1414)
T KOG1473|consen 406 NVDSIRHTPIGRDRYGRKYW-FISRRLRIEG 435 (1414)
T ss_pred cccceeccCCCcCccccchh-ceeeeeEEec
Confidence 45779999999999999999 6778888776
No 5
>COG5397 Uncharacterized conserved protein [Function unknown]
Probab=76.42 E-value=1.7 Score=36.48 Aligned_cols=19 Identities=37% Similarity=0.857 Sum_probs=16.1
Q ss_pred CceeeeeceecCCCceEEEEe
Q psy16436 11 DSLRLQPLGYDRNQSAFWYFY 31 (94)
Q Consensus 11 DsLRvePLG~D~ngs~YWYFy 31 (94)
+.-|..|. |.||-.||||=
T Consensus 31 ~e~rftp~--~~kgR~YWYfd 49 (349)
T COG5397 31 AEGRFTPT--DRKGRVYWYFD 49 (349)
T ss_pred CCCccccc--ccCCceEEEEe
Confidence 45688887 99999999993
No 6
>PF05071 NDUFA12: NADH ubiquinone oxidoreductase subunit NDUFA12; InterPro: IPR007763 NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. this entry represents the 17.2kDa subunit from NADH:ubiquinone oxidoreductase and its homologues []. This subunit is believed to be one of the 36 structural complex I proteins.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0009055 electron carrier activity, 0016020 membrane
Probab=54.46 E-value=7.5 Score=26.22 Aligned_cols=14 Identities=14% Similarity=0.199 Sum_probs=13.2
Q ss_pred ceecCCCceEEEEe
Q psy16436 18 LGYDRNQSAFWYFY 31 (94)
Q Consensus 18 LG~D~ngs~YWYFy 31 (94)
+|.|..|+.||-+.
T Consensus 4 VG~D~~GN~YyE~~ 17 (105)
T PF05071_consen 4 VGTDEFGNKYYENP 17 (105)
T ss_pred eeEeCCCCEEEeec
Confidence 79999999999988
No 7
>KOG1245|consensus
Probab=47.73 E-value=7.9 Score=36.87 Aligned_cols=30 Identities=43% Similarity=0.719 Sum_probs=23.7
Q ss_pred CCceeeeeceecCCCceEEEEe--eeeeeeec
Q psy16436 10 SDSLRLQPLGYDRNQSAFWYFY--GTRLYRED 39 (94)
Q Consensus 10 aDsLRvePLG~D~ngs~YWYFy--GTRLYrEd 39 (94)
..++|..|||.|++..-||-|- +.++.-|+
T Consensus 819 ~~~~r~~~lG~DR~~rRYwvl~~~~~~~~ie~ 850 (1404)
T KOG1245|consen 819 SLVLRLNPLGKDRNYRRYWVLPDLVSGLFIEE 850 (1404)
T ss_pred HHHhhccccccchhhceeeeeeccCcccchhH
Confidence 4578999999999999999997 43454444
No 8
>PF01820 Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; InterPro: IPR011127 This entry represents the N-terminal region of the D-alanine--D-alanine ligase enzyme (6.3.2.4 from EC) which is thought to be involved in substrate binding []. D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine:D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF) [].; GO: 0008716 D-alanine-D-alanine ligase activity, 0009252 peptidoglycan biosynthetic process, 0005618 cell wall; PDB: 4EG0_B 3E5N_A 3RFC_A 3R5F_A 1IOV_A 1IOW_A 2DLN_A 3Q1K_D 3I12_C 3N8D_B ....
Probab=44.60 E-value=18 Score=24.13 Aligned_cols=27 Identities=19% Similarity=0.421 Sum_probs=22.0
Q ss_pred hhhccCCCCceeeeeceecCCCceEEEEe
Q psy16436 3 LAVYNLESDSLRLQPLGYDRNQSAFWYFY 31 (94)
Q Consensus 3 ~~lk~LdaDsLRvePLG~D~ngs~YWYFy 31 (94)
..+++|+.+.-.+.|++.|++| .|+-.
T Consensus 23 ~v~~~L~~~~y~v~~i~i~k~g--~~~~~ 49 (117)
T PF01820_consen 23 NVYEALDKEKYEVIPIYIDKDG--RWYLG 49 (117)
T ss_dssp HHHHHSHTTTEEEEEEEETTTS--CEEEE
T ss_pred HHHHHHhhhcceEEEEeecCCC--CEEEc
Confidence 3567889999999999999999 45443
No 9
>PF00568 WH1: WH1 domain; InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the proline-rich motif FPPPP with low-affinity, further interactions then form between flanking residues [][]. WASP family proteins contain a EVH1 (WH1) in their N-terminals which bind proline-rich sequences in the WASP interacting protein. Proteins of the RanBP1 family contain a WH1 domain in their N-terminal region, which seems to bind a different sequence motif present in the C-terminal part of RanGTP protein [,]. Tertiary structure of the WH1 domain of the Mena protein revealed structure similarities with the pleckstrin homology (PH) domain. The overall fold consists of a compact parallel beta-sandwich, closed along one edge by a long alpha-helix. A highly conserved cluster of three surface-exposed aromatic side-chains forms the recognition site for the molecules target ligands. [].; GO: 0005515 protein binding; PDB: 1I2H_A 1DDV_A 1DDW_A 1EGX_A 3SYX_A 1TJ6_B 1XOD_B 1EVH_A 1I7A_B 2JP2_A ....
Probab=44.53 E-value=62 Score=21.31 Aligned_cols=40 Identities=18% Similarity=0.428 Sum_probs=21.7
Q ss_pred CccccceeEEEEEEee---eeecCccceeeeeeccceEeeecc
Q psy16436 47 DMLPIPCTNIAIVGLS---VEANSPKGWVKLLESSHCCITKQA 86 (94)
Q Consensus 47 ~~l~l~c~~i~iv~ls---~~~~~~~~~~~~~~~~~~~~~~~~ 86 (94)
++|...|..|+.++-- .+.++.++|++..-....|+.|..
T Consensus 2 ~~lg~~~~~i~~~vA~v~~~~p~~~~~W~~~~~~g~v~~v~d~ 44 (111)
T PF00568_consen 2 RLLGRRCQSIATAVAQVYQADPDTKRQWSPVKGTGVVCFVKDN 44 (111)
T ss_dssp SSS---EEEEEEEEEEEEEEETTTSESEEESSSEEEEEEEEET
T ss_pred cccCcCceEEEEEEEEEEEEEcCCCCcEeeCCeEEEEEEEEEC
Confidence 3566677766654433 344555569996555566666643
No 10
>PHA00008 J DNA packaging protein
Probab=37.72 E-value=26 Score=20.04 Aligned_cols=16 Identities=31% Similarity=0.740 Sum_probs=13.3
Q ss_pred ecCCCceEEEEeeeee
Q psy16436 20 YDRNQSAFWYFYGTRL 35 (94)
Q Consensus 20 ~D~ngs~YWYFyGTRL 35 (94)
.-++|+-.||-.||..
T Consensus 10 ~r~KGARLWYVGGtQf 25 (26)
T PHA00008 10 SRRKGARLWYVGGTQF 25 (26)
T ss_pred CccCceEEEEeccEEc
Confidence 4678999999999863
No 11
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain. ProRS is a homodimer. It is responsible for the attachment of proline to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain.
Probab=30.90 E-value=29 Score=26.09 Aligned_cols=26 Identities=27% Similarity=0.109 Sum_probs=20.8
Q ss_pred eecCccceeeeeeccceEeeeccCCC
Q psy16436 64 EANSPKGWVKLLESSHCCITKQAGPV 89 (94)
Q Consensus 64 ~~~~~~~~~~~~~~~~~~~~~~~~~~ 89 (94)
|+-.|.|..+-+|++|||-..|+-.-
T Consensus 204 e~~~p~~~~~~~~~~~~~~~~~~~~~ 229 (264)
T cd00772 204 EALMEDGKAKQAETGHIFGEGFARAF 229 (264)
T ss_pred EEECCCCCEeEEEeeeeccCCchhhc
Confidence 45567788899999999998887643
No 12
>PF06970 RepA_N: Replication initiator protein A (RepA) N-terminus; InterPro: IPR010724 This entry represents the N terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids []. Most proteins in this entry are bacterial, but archaeal and eukaryotic members are also included.
Probab=27.47 E-value=46 Score=21.53 Aligned_cols=14 Identities=21% Similarity=0.180 Sum_probs=11.7
Q ss_pred ceecCCCceEEEEe
Q psy16436 18 LGYDRNQSAFWYFY 31 (94)
Q Consensus 18 LG~D~ngs~YWYFy 31 (94)
=-+|.+|..|.+|-
T Consensus 41 ~wiDe~G~vYi~~s 54 (76)
T PF06970_consen 41 GWIDENGNVYIIFS 54 (76)
T ss_pred CcCCCCCCEEEEee
Confidence 35899999999984
No 13
>KOG3388|consensus
Probab=26.67 E-value=31 Score=25.90 Aligned_cols=18 Identities=22% Similarity=0.647 Sum_probs=13.0
Q ss_pred eeeceecCCCceEEEEee
Q psy16436 15 LQPLGYDRNQSAFWYFYG 32 (94)
Q Consensus 15 vePLG~D~ngs~YWYFyG 32 (94)
|.=|++|.+|-.|+|=||
T Consensus 78 iDvl~v~~~G~~~YyaFg 95 (136)
T KOG3388|consen 78 IDVLEVDSEGGDYYYAFG 95 (136)
T ss_pred ceEEEEecCCceEEEeeC
Confidence 344789999987777555
No 14
>PRK14661 acpS 4'-phosphopantetheinyl transferase; Provisional
Probab=23.62 E-value=22 Score=26.76 Aligned_cols=19 Identities=53% Similarity=0.936 Sum_probs=14.6
Q ss_pred cCcccee-----------eeeeccceEeee
Q psy16436 66 NSPKGWV-----------KLLESSHCCITK 84 (94)
Q Consensus 66 ~~~~~~~-----------~~~~~~~~~~~~ 84 (94)
.|-+||- |+||+|||-...
T Consensus 132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 161 (169)
T PRK14661 132 RSVEGWEIETSLPPFTLKKLLESSGCRLVR 161 (169)
T ss_pred ccccceEeecCCCchHHHHHHhhcCceEEE
Confidence 4678884 899999997654
No 15
>PF11049 KSHV_K1: Glycoprotein K1 of Kaposi's sarcoma-associated herpes virus; InterPro: IPR021022 This is a highly glycosylated cytoplasmic and membrane protein similar to the immunoglobulin receptor family that is expressed as an inducible early-lytic-cycle gene product in primary effusion lymphoma cell-lines. This domain would appear to be the cytoplasmic region of the protein [].
Probab=23.50 E-value=44 Score=22.79 Aligned_cols=16 Identities=44% Similarity=0.721 Sum_probs=13.1
Q ss_pred ceEEEEeeeeeeeecC
Q psy16436 25 SAFWYFYGTRLYREDY 40 (94)
Q Consensus 25 s~YWYFyGTRLYrEdp 40 (94)
-..||-=||||+|=..
T Consensus 12 PiswYcN~TRLlRlt~ 27 (71)
T PF11049_consen 12 PISWYCNGTRLLRLTQ 27 (71)
T ss_pred cccEEECCceeeeecC
Confidence 3579999999999654
No 16
>PF13642 DUF4144: protein structure with unknown function; PDB: 2L6O_A.
Probab=23.08 E-value=24 Score=24.33 Aligned_cols=9 Identities=44% Similarity=1.121 Sum_probs=4.2
Q ss_pred cceEeeecc
Q psy16436 78 SHCCITKQA 86 (94)
Q Consensus 78 ~~~~~~~~~ 86 (94)
.|||++|-.
T Consensus 81 g~cC~~Ki~ 89 (101)
T PF13642_consen 81 GQCCIAKIQ 89 (101)
T ss_dssp T---SSSSS
T ss_pred CCeeeeccc
Confidence 589999853
No 17
>PF04726 Microvir_J: Microvirus J protein; InterPro: IPR006815 This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic C terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions [].; GO: 0003677 DNA binding, 0019073 viral DNA genome packaging, 0019028 viral capsid; PDB: 1M06_J 1GFF_3 1RB8_J 2BPA_3.
Probab=21.93 E-value=24 Score=19.82 Aligned_cols=16 Identities=38% Similarity=0.808 Sum_probs=6.9
Q ss_pred eecCCCceEEEEeeee
Q psy16436 19 GYDRNQSAFWYFYGTR 34 (94)
Q Consensus 19 G~D~ngs~YWYFyGTR 34 (94)
|--++|+-.||-.||.
T Consensus 8 ~~~~kgarlwyvgg~q 23 (24)
T PF04726_consen 8 GGKRKGARLWYVGGTQ 23 (24)
T ss_dssp --SSSSS----SSS--
T ss_pred CCccCceEEEEeccee
Confidence 3568899999988874
No 18
>cd08159 APC10-like APC10-like DOC1 domains in E3 ubiquitin ligases that mediate substrate ubiquitination. This family contains the single domain protein, APC10, a subunit of the anaphase-promoting complex (APC), as well as the DOC1 domain of multi-domain proteins present in E3 ubiquitin ligases. E3 ubiquitin ligases mediate substrate ubiquitination (or ubiquitylation), a component of the ubiquitin-26S proteasome pathway for selective proteolytic degradation. The APC, a multi-protein complex (or cyclosome), is a cell cycle-regulated, E3 ubiquitin ligase that controls important transitions in mitosis and the G1 phase by ubiquitinating regulatory proteins, thereby targeting them for degradation. APC10-like DOC1 domains such as those present in HECT (Homologous to the E6-AP Carboxyl Terminus) and Cullin-RING (Really Interesting New Gene) E3 ubiquitin ligase proteins, HECTD3, and CUL7, respectively, are also included in this hierarchy. CUL7 is a member of the Cullin-RING ligase family and f
Probab=21.91 E-value=63 Score=23.02 Aligned_cols=15 Identities=47% Similarity=0.917 Sum_probs=12.4
Q ss_pred eeecCccceeeeeec
Q psy16436 63 VEANSPKGWVKLLES 77 (94)
Q Consensus 63 ~~~~~~~~~~~~~~~ 77 (94)
++-+.|.|||.+++.
T Consensus 85 v~l~~p~Gwv~i~~~ 99 (129)
T cd08159 85 VNIRPSNGWVALLED 99 (129)
T ss_pred EEecCCCceEEEEcC
Confidence 566789999999875
No 19
>PLN03095 NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional
Probab=21.10 E-value=54 Score=23.46 Aligned_cols=15 Identities=13% Similarity=0.220 Sum_probs=12.5
Q ss_pred eeceecCCCceEEEE
Q psy16436 16 QPLGYDRNQSAFWYF 30 (94)
Q Consensus 16 ePLG~D~ngs~YWYF 30 (94)
+=+|.|..|+.||-.
T Consensus 11 ~lVG~D~~GNkYYE~ 25 (115)
T PLN03095 11 RLVGEDEFGNKYYEN 25 (115)
T ss_pred eEeEEcCCCCeeeEc
Confidence 448999999999864
No 20
>PF00803 3A: 3A/RNA2 movement protein family; InterPro: IPR000603 This entry includes movement proteins from various viruses. The 3A protein is found in Bromoviruses and Cucumoviruses, whose genomes contain 3 RNA segments. The third segment (RNA 3) contains two proteins, the coat protein and the 3A protein. The function of the 3A protein is uncertain, but has been shown to be involved in cell-to-cell movement of the virus []. The entry also includes movement proteins from Dianthoviruses.
Probab=21.06 E-value=47 Score=25.36 Aligned_cols=17 Identities=12% Similarity=0.133 Sum_probs=14.2
Q ss_pred CCCccccceeEEEEEEe
Q psy16436 45 GEDMLPIPCTNIAIVGL 61 (94)
Q Consensus 45 ~~~~l~l~c~~i~iv~l 61 (94)
++|.+.++|++|+||--
T Consensus 72 s~G~m~i~~Vl~~vvPt 88 (234)
T PF00803_consen 72 SNGYMSISRVLVWVVPT 88 (234)
T ss_pred CCccEEEeeEEEEEcCC
Confidence 66799999999988754
Done!