Query         psy16436
Match_columns 94
No_of_seqs    32 out of 34
Neff          1.8 
Searched_HMMs 46136
Date          Fri Aug 16 21:14:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16436.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16436hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF15613 WHIM2:  WSTF, HB1, Itc  97.9 1.2E-05 2.5E-10   47.8   3.3   17   14-30      1-17  (38)
  2 KOG1472|consensus               90.2   0.031 6.6E-07   49.7  -2.7   45    4-50     10-54  (720)
  3 PF14298 DUF4374:  Domain of un  77.6     2.7 5.9E-05   35.6   3.3   40    5-44     40-80  (435)
  4 KOG1473|consensus               76.8     1.8 3.9E-05   41.6   2.3   30    9-39    406-435 (1414)
  5 COG5397 Uncharacterized conser  76.4     1.7 3.7E-05   36.5   1.8   19   11-31     31-49  (349)
  6 PF05071 NDUFA12:  NADH ubiquin  54.5     7.5 0.00016   26.2   1.3   14   18-31      4-17  (105)
  7 KOG1245|consensus               47.7     7.9 0.00017   36.9   0.7   30   10-39    819-850 (1404)
  8 PF01820 Dala_Dala_lig_N:  D-al  44.6      18 0.00039   24.1   1.9   27    3-31     23-49  (117)
  9 PF00568 WH1:  WH1 domain;  Int  44.5      62  0.0013   21.3   4.4   40   47-86      2-44  (111)
 10 PHA00008 J DNA packaging prote  37.7      26 0.00055   20.0   1.5   16   20-35     10-25  (26)
 11 cd00772 ProRS_core Prolyl-tRNA  30.9      29 0.00063   26.1   1.3   26   64-89    204-229 (264)
 12 PF06970 RepA_N:  Replication i  27.5      46 0.00099   21.5   1.6   14   18-31     41-54  (76)
 13 KOG3388|consensus               26.7      31 0.00067   25.9   0.8   18   15-32     78-95  (136)
 14 PRK14661 acpS 4'-phosphopantet  23.6      22 0.00048   26.8  -0.4   19   66-84    132-161 (169)
 15 PF11049 KSHV_K1:  Glycoprotein  23.5      44 0.00095   22.8   1.0   16   25-40     12-27  (71)
 16 PF13642 DUF4144:  protein stru  23.1      24 0.00052   24.3  -0.3    9   78-86     81-89  (101)
 17 PF04726 Microvir_J:  Microviru  21.9      24 0.00052   19.8  -0.4   16   19-34      8-23  (24)
 18 cd08159 APC10-like APC10-like   21.9      63  0.0014   23.0   1.6   15   63-77     85-99  (129)
 19 PLN03095 NADH:ubiquinone oxido  21.1      54  0.0012   23.5   1.2   15   16-30     11-25  (115)
 20 PF00803 3A:  3A/RNA2 movement   21.1      47   0.001   25.4   0.9   17   45-61     72-88  (234)

No 1  
>PF15613 WHIM2:  WSTF, HB1, Itc1p, MBD9 motif 2
Probab=97.93  E-value=1.2e-05  Score=47.81  Aligned_cols=17  Identities=53%  Similarity=1.253  Sum_probs=16.6

Q ss_pred             eeeeceecCCCceEEEE
Q psy16436         14 RLQPLGYDRNQSAFWYF   30 (94)
Q Consensus        14 RvePLG~D~ngs~YWYF   30 (94)
                      |++|||.|+.++.||+|
T Consensus         1 R~~pLG~DR~~NrYwwf   17 (38)
T PF15613_consen    1 RLKPLGKDRYGNRYWWF   17 (38)
T ss_pred             CcccccccCCCceEEEE
Confidence            78999999999999999


No 2  
>KOG1472|consensus
Probab=90.23  E-value=0.031  Score=49.68  Aligned_cols=45  Identities=27%  Similarity=0.321  Sum_probs=39.5

Q ss_pred             hhccCCCCceeeeeceecCCCceEEEEeeeeeeeecCCCCCCCCccc
Q psy16436          4 AVYNLESDSLRLQPLGYDRNQSAFWYFYGTRLYREDYPKVDGEDMLP   50 (94)
Q Consensus         4 ~lk~LdaDsLRvePLG~D~ngs~YWYFyGTRLYrEdp~~~~~~~~l~   50 (94)
                      .+++.+.|+++.+||+.+..  .+|||+|||.+.+++......+.+.
T Consensus        10 ~~~~~~~~~~~~~~l~e~~~--l~~~~~~~~~~~l~~vs~~~~~~~~   54 (720)
T KOG1472|consen   10 LLKPRDDDSLIAEPLNELCS--LCWHFLGTRISHLDNVSGKSNNELL   54 (720)
T ss_pred             cCCCchhhhhhcchhhhhhh--hhhhhhhhhhhcccccchhhhhhhH
Confidence            46788999999999999988  9999999999999998887766553


No 3  
>PF14298 DUF4374:  Domain of unknown function (DUF4374)
Probab=77.61  E-value=2.7  Score=35.64  Aligned_cols=40  Identities=20%  Similarity=0.512  Sum_probs=33.1

Q ss_pred             hccCCCCceeeeeceecCCCceEEEEeeee-eeeecCCCCC
Q psy16436          5 VYNLESDSLRLQPLGYDRNQSAFWYFYGTR-LYREDYPKVD   44 (94)
Q Consensus         5 lk~LdaDsLRvePLG~D~ngs~YWYFyGTR-LYrEdp~~~~   44 (94)
                      ..+|+..++-+.-=|....|..||||++.+ +|.=.+-++.
T Consensus        40 a~sL~~G~Is~~gNG~e~dg~~~w~f~~~~~~~~l~Y~qGn   80 (435)
T PF14298_consen   40 AESLDEGSISTKGNGLEQDGTYYWYFYKNNYAFGLLYGQGN   80 (435)
T ss_pred             ecccCCceEEeecCcEEecceeEEEEcCCcEEEEEEecCCC
Confidence            357888899998899999999999999997 7776665544


No 4  
>KOG1473|consensus
Probab=76.81  E-value=1.8  Score=41.56  Aligned_cols=30  Identities=40%  Similarity=0.756  Sum_probs=26.0

Q ss_pred             CCCceeeeeceecCCCceEEEEeeeeeeeec
Q psy16436          9 ESDSLRLQPLGYDRNQSAFWYFYGTRLYRED   39 (94)
Q Consensus         9 daDsLRvePLG~D~ngs~YWYFyGTRLYrEd   39 (94)
                      +.|++|-+|+|.|+.|..|| |..-||.-|+
T Consensus       406 ~~~~iR~~~iG~dr~gr~yw-fi~rrl~Ie~  435 (1414)
T KOG1473|consen  406 NVDSIRHTPIGRDRYGRKYW-FISRRLRIEG  435 (1414)
T ss_pred             cccceeccCCCcCccccchh-ceeeeeEEec
Confidence            45779999999999999999 6778888776


No 5  
>COG5397 Uncharacterized conserved protein [Function unknown]
Probab=76.42  E-value=1.7  Score=36.48  Aligned_cols=19  Identities=37%  Similarity=0.857  Sum_probs=16.1

Q ss_pred             CceeeeeceecCCCceEEEEe
Q psy16436         11 DSLRLQPLGYDRNQSAFWYFY   31 (94)
Q Consensus        11 DsLRvePLG~D~ngs~YWYFy   31 (94)
                      +.-|..|.  |.||-.||||=
T Consensus        31 ~e~rftp~--~~kgR~YWYfd   49 (349)
T COG5397          31 AEGRFTPT--DRKGRVYWYFD   49 (349)
T ss_pred             CCCccccc--ccCCceEEEEe
Confidence            45688887  99999999993


No 6  
>PF05071 NDUFA12:  NADH ubiquinone oxidoreductase subunit NDUFA12;  InterPro: IPR007763  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. this entry represents the 17.2kDa subunit from NADH:ubiquinone oxidoreductase and its homologues []. This subunit is believed to be one of the 36 structural complex I proteins.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0009055 electron carrier activity, 0016020 membrane
Probab=54.46  E-value=7.5  Score=26.22  Aligned_cols=14  Identities=14%  Similarity=0.199  Sum_probs=13.2

Q ss_pred             ceecCCCceEEEEe
Q psy16436         18 LGYDRNQSAFWYFY   31 (94)
Q Consensus        18 LG~D~ngs~YWYFy   31 (94)
                      +|.|..|+.||-+.
T Consensus         4 VG~D~~GN~YyE~~   17 (105)
T PF05071_consen    4 VGTDEFGNKYYENP   17 (105)
T ss_pred             eeEeCCCCEEEeec
Confidence            79999999999988


No 7  
>KOG1245|consensus
Probab=47.73  E-value=7.9  Score=36.87  Aligned_cols=30  Identities=43%  Similarity=0.719  Sum_probs=23.7

Q ss_pred             CCceeeeeceecCCCceEEEEe--eeeeeeec
Q psy16436         10 SDSLRLQPLGYDRNQSAFWYFY--GTRLYRED   39 (94)
Q Consensus        10 aDsLRvePLG~D~ngs~YWYFy--GTRLYrEd   39 (94)
                      ..++|..|||.|++..-||-|-  +.++.-|+
T Consensus       819 ~~~~r~~~lG~DR~~rRYwvl~~~~~~~~ie~  850 (1404)
T KOG1245|consen  819 SLVLRLNPLGKDRNYRRYWVLPDLVSGLFIEE  850 (1404)
T ss_pred             HHHhhccccccchhhceeeeeeccCcccchhH
Confidence            4578999999999999999997  43454444


No 8  
>PF01820 Dala_Dala_lig_N:  D-ala D-ala ligase N-terminus;  InterPro: IPR011127 This entry represents the N-terminal region of the D-alanine--D-alanine ligase enzyme (6.3.2.4 from EC) which is thought to be involved in substrate binding []. D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine:D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF) [].; GO: 0008716 D-alanine-D-alanine ligase activity, 0009252 peptidoglycan biosynthetic process, 0005618 cell wall; PDB: 4EG0_B 3E5N_A 3RFC_A 3R5F_A 1IOV_A 1IOW_A 2DLN_A 3Q1K_D 3I12_C 3N8D_B ....
Probab=44.60  E-value=18  Score=24.13  Aligned_cols=27  Identities=19%  Similarity=0.421  Sum_probs=22.0

Q ss_pred             hhhccCCCCceeeeeceecCCCceEEEEe
Q psy16436          3 LAVYNLESDSLRLQPLGYDRNQSAFWYFY   31 (94)
Q Consensus         3 ~~lk~LdaDsLRvePLG~D~ngs~YWYFy   31 (94)
                      ..+++|+.+.-.+.|++.|++|  .|+-.
T Consensus        23 ~v~~~L~~~~y~v~~i~i~k~g--~~~~~   49 (117)
T PF01820_consen   23 NVYEALDKEKYEVIPIYIDKDG--RWYLG   49 (117)
T ss_dssp             HHHHHSHTTTEEEEEEEETTTS--CEEEE
T ss_pred             HHHHHHhhhcceEEEEeecCCC--CEEEc
Confidence            3567889999999999999999  45443


No 9  
>PF00568 WH1:  WH1 domain;  InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the proline-rich motif FPPPP with low-affinity, further interactions then form between flanking residues [][].  WASP family proteins contain a EVH1 (WH1) in their N-terminals which bind proline-rich sequences in the WASP interacting protein. Proteins of the RanBP1 family contain a WH1 domain in their N-terminal region, which seems to bind a different sequence motif present in the C-terminal part of RanGTP protein [,].  Tertiary structure of the WH1 domain of the Mena protein revealed structure similarities with the pleckstrin homology (PH) domain. The overall fold consists of a compact parallel beta-sandwich, closed along one edge by a long alpha-helix. A highly conserved cluster of three surface-exposed aromatic side-chains forms the recognition site for the molecules target ligands. [].; GO: 0005515 protein binding; PDB: 1I2H_A 1DDV_A 1DDW_A 1EGX_A 3SYX_A 1TJ6_B 1XOD_B 1EVH_A 1I7A_B 2JP2_A ....
Probab=44.53  E-value=62  Score=21.31  Aligned_cols=40  Identities=18%  Similarity=0.428  Sum_probs=21.7

Q ss_pred             CccccceeEEEEEEee---eeecCccceeeeeeccceEeeecc
Q psy16436         47 DMLPIPCTNIAIVGLS---VEANSPKGWVKLLESSHCCITKQA   86 (94)
Q Consensus        47 ~~l~l~c~~i~iv~ls---~~~~~~~~~~~~~~~~~~~~~~~~   86 (94)
                      ++|...|..|+.++--   .+.++.++|++..-....|+.|..
T Consensus         2 ~~lg~~~~~i~~~vA~v~~~~p~~~~~W~~~~~~g~v~~v~d~   44 (111)
T PF00568_consen    2 RLLGRRCQSIATAVAQVYQADPDTKRQWSPVKGTGVVCFVKDN   44 (111)
T ss_dssp             SSS---EEEEEEEEEEEEEEETTTSESEEESSSEEEEEEEEET
T ss_pred             cccCcCceEEEEEEEEEEEEEcCCCCcEeeCCeEEEEEEEEEC
Confidence            3566677766654433   344555569996555566666643


No 10 
>PHA00008 J DNA packaging protein
Probab=37.72  E-value=26  Score=20.04  Aligned_cols=16  Identities=31%  Similarity=0.740  Sum_probs=13.3

Q ss_pred             ecCCCceEEEEeeeee
Q psy16436         20 YDRNQSAFWYFYGTRL   35 (94)
Q Consensus        20 ~D~ngs~YWYFyGTRL   35 (94)
                      .-++|+-.||-.||..
T Consensus        10 ~r~KGARLWYVGGtQf   25 (26)
T PHA00008         10 SRRKGARLWYVGGTQF   25 (26)
T ss_pred             CccCceEEEEeccEEc
Confidence            4678999999999863


No 11 
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain. ProRS is a homodimer. It is responsible for the attachment of proline to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain.
Probab=30.90  E-value=29  Score=26.09  Aligned_cols=26  Identities=27%  Similarity=0.109  Sum_probs=20.8

Q ss_pred             eecCccceeeeeeccceEeeeccCCC
Q psy16436         64 EANSPKGWVKLLESSHCCITKQAGPV   89 (94)
Q Consensus        64 ~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (94)
                      |+-.|.|..+-+|++|||-..|+-.-
T Consensus       204 e~~~p~~~~~~~~~~~~~~~~~~~~~  229 (264)
T cd00772         204 EALMEDGKAKQAETGHIFGEGFARAF  229 (264)
T ss_pred             EEECCCCCEeEEEeeeeccCCchhhc
Confidence            45567788899999999998887643


No 12 
>PF06970 RepA_N:  Replication initiator protein A (RepA) N-terminus;  InterPro: IPR010724 This entry represents the N terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids []. Most proteins in this entry are bacterial, but archaeal and eukaryotic members are also included.
Probab=27.47  E-value=46  Score=21.53  Aligned_cols=14  Identities=21%  Similarity=0.180  Sum_probs=11.7

Q ss_pred             ceecCCCceEEEEe
Q psy16436         18 LGYDRNQSAFWYFY   31 (94)
Q Consensus        18 LG~D~ngs~YWYFy   31 (94)
                      =-+|.+|..|.+|-
T Consensus        41 ~wiDe~G~vYi~~s   54 (76)
T PF06970_consen   41 GWIDENGNVYIIFS   54 (76)
T ss_pred             CcCCCCCCEEEEee
Confidence            35899999999984


No 13 
>KOG3388|consensus
Probab=26.67  E-value=31  Score=25.90  Aligned_cols=18  Identities=22%  Similarity=0.647  Sum_probs=13.0

Q ss_pred             eeeceecCCCceEEEEee
Q psy16436         15 LQPLGYDRNQSAFWYFYG   32 (94)
Q Consensus        15 vePLG~D~ngs~YWYFyG   32 (94)
                      |.=|++|.+|-.|+|=||
T Consensus        78 iDvl~v~~~G~~~YyaFg   95 (136)
T KOG3388|consen   78 IDVLEVDSEGGDYYYAFG   95 (136)
T ss_pred             ceEEEEecCCceEEEeeC
Confidence            344789999987777555


No 14 
>PRK14661 acpS 4'-phosphopantetheinyl transferase; Provisional
Probab=23.62  E-value=22  Score=26.76  Aligned_cols=19  Identities=53%  Similarity=0.936  Sum_probs=14.6

Q ss_pred             cCcccee-----------eeeeccceEeee
Q psy16436         66 NSPKGWV-----------KLLESSHCCITK   84 (94)
Q Consensus        66 ~~~~~~~-----------~~~~~~~~~~~~   84 (94)
                      .|-+||-           |+||+|||-...
T Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (169)
T PRK14661        132 RSVEGWEIETSLPPFTLKKLLESSGCRLVR  161 (169)
T ss_pred             ccccceEeecCCCchHHHHHHhhcCceEEE
Confidence            4678884           899999997654


No 15 
>PF11049 KSHV_K1:  Glycoprotein K1 of Kaposi's sarcoma-associated herpes virus;  InterPro: IPR021022  This is a highly glycosylated cytoplasmic and membrane protein similar to the immunoglobulin receptor family that is expressed as an inducible early-lytic-cycle gene product in primary effusion lymphoma cell-lines. This domain would appear to be the cytoplasmic region of the protein []. 
Probab=23.50  E-value=44  Score=22.79  Aligned_cols=16  Identities=44%  Similarity=0.721  Sum_probs=13.1

Q ss_pred             ceEEEEeeeeeeeecC
Q psy16436         25 SAFWYFYGTRLYREDY   40 (94)
Q Consensus        25 s~YWYFyGTRLYrEdp   40 (94)
                      -..||-=||||+|=..
T Consensus        12 PiswYcN~TRLlRlt~   27 (71)
T PF11049_consen   12 PISWYCNGTRLLRLTQ   27 (71)
T ss_pred             cccEEECCceeeeecC
Confidence            3579999999999654


No 16 
>PF13642 DUF4144:  protein structure with unknown function; PDB: 2L6O_A.
Probab=23.08  E-value=24  Score=24.33  Aligned_cols=9  Identities=44%  Similarity=1.121  Sum_probs=4.2

Q ss_pred             cceEeeecc
Q psy16436         78 SHCCITKQA   86 (94)
Q Consensus        78 ~~~~~~~~~   86 (94)
                      .|||++|-.
T Consensus        81 g~cC~~Ki~   89 (101)
T PF13642_consen   81 GQCCIAKIQ   89 (101)
T ss_dssp             T---SSSSS
T ss_pred             CCeeeeccc
Confidence            589999853


No 17 
>PF04726 Microvir_J:  Microvirus J protein;  InterPro: IPR006815 This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic C terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions [].; GO: 0003677 DNA binding, 0019073 viral DNA genome packaging, 0019028 viral capsid; PDB: 1M06_J 1GFF_3 1RB8_J 2BPA_3.
Probab=21.93  E-value=24  Score=19.82  Aligned_cols=16  Identities=38%  Similarity=0.808  Sum_probs=6.9

Q ss_pred             eecCCCceEEEEeeee
Q psy16436         19 GYDRNQSAFWYFYGTR   34 (94)
Q Consensus        19 G~D~ngs~YWYFyGTR   34 (94)
                      |--++|+-.||-.||.
T Consensus         8 ~~~~kgarlwyvgg~q   23 (24)
T PF04726_consen    8 GGKRKGARLWYVGGTQ   23 (24)
T ss_dssp             --SSSSS----SSS--
T ss_pred             CCccCceEEEEeccee
Confidence            3568899999988874


No 18 
>cd08159 APC10-like APC10-like DOC1 domains in E3 ubiquitin ligases that mediate substrate ubiquitination. This family contains the single domain protein, APC10, a subunit of the anaphase-promoting complex (APC), as well as the DOC1 domain of multi-domain proteins present in E3 ubiquitin ligases. E3 ubiquitin ligases mediate substrate ubiquitination (or ubiquitylation), a component of the ubiquitin-26S proteasome pathway for selective proteolytic degradation. The APC, a multi-protein complex (or cyclosome), is a cell cycle-regulated, E3 ubiquitin ligase that controls important transitions in mitosis and the G1 phase by ubiquitinating regulatory proteins, thereby targeting them for degradation. APC10-like DOC1 domains such as those present in HECT (Homologous to the E6-AP Carboxyl Terminus) and Cullin-RING (Really Interesting New Gene) E3 ubiquitin ligase proteins, HECTD3, and CUL7, respectively, are also included in this hierarchy. CUL7 is a member of the Cullin-RING ligase family and f
Probab=21.91  E-value=63  Score=23.02  Aligned_cols=15  Identities=47%  Similarity=0.917  Sum_probs=12.4

Q ss_pred             eeecCccceeeeeec
Q psy16436         63 VEANSPKGWVKLLES   77 (94)
Q Consensus        63 ~~~~~~~~~~~~~~~   77 (94)
                      ++-+.|.|||.+++.
T Consensus        85 v~l~~p~Gwv~i~~~   99 (129)
T cd08159          85 VNIRPSNGWVALLED   99 (129)
T ss_pred             EEecCCCceEEEEcC
Confidence            566789999999875


No 19 
>PLN03095 NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional
Probab=21.10  E-value=54  Score=23.46  Aligned_cols=15  Identities=13%  Similarity=0.220  Sum_probs=12.5

Q ss_pred             eeceecCCCceEEEE
Q psy16436         16 QPLGYDRNQSAFWYF   30 (94)
Q Consensus        16 ePLG~D~ngs~YWYF   30 (94)
                      +=+|.|..|+.||-.
T Consensus        11 ~lVG~D~~GNkYYE~   25 (115)
T PLN03095         11 RLVGEDEFGNKYYEN   25 (115)
T ss_pred             eEeEEcCCCCeeeEc
Confidence            448999999999864


No 20 
>PF00803 3A:  3A/RNA2 movement protein family;  InterPro: IPR000603 This entry includes movement proteins from various viruses. The 3A protein is found in Bromoviruses and Cucumoviruses, whose genomes contain 3 RNA segments. The third segment (RNA 3) contains two proteins, the coat protein and the 3A protein. The function of the 3A protein is uncertain, but has been shown to be involved in cell-to-cell movement of the virus []. The entry also includes movement proteins from Dianthoviruses.
Probab=21.06  E-value=47  Score=25.36  Aligned_cols=17  Identities=12%  Similarity=0.133  Sum_probs=14.2

Q ss_pred             CCCccccceeEEEEEEe
Q psy16436         45 GEDMLPIPCTNIAIVGL   61 (94)
Q Consensus        45 ~~~~l~l~c~~i~iv~l   61 (94)
                      ++|.+.++|++|+||--
T Consensus        72 s~G~m~i~~Vl~~vvPt   88 (234)
T PF00803_consen   72 SNGYMSISRVLVWVVPT   88 (234)
T ss_pred             CCccEEEeeEEEEEcCC
Confidence            66799999999988754


Done!