Diaphorina citri psyllid: psy16455


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MHMKGPHYKKRPPRQPLLGKPFAKGKEMVAYIPGEGHNLQEHNIVLCKVGRVKDLPGVKIKCVRGVYDLPHVVKKTQLTPGK
cccccccccccccccccCEEEcccccEEEEEEccccccccccEEEEEEcccccccccccEEEEECccccccccccccccccc
*****************LGKPFAKGKEMVAYIPGEGHNLQEHNIVLCKVGRVKDLPGVKIKCVRGVYDLPH***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHMKGPHYKKRPPRQPLLGKPFAKGKEMVAYIPGEGHNLQEHNIVLCKVGRVKDLPGVKIKCVRGVYDLPHVVKKTQLTPGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S12 Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.confidentB3PMF1
30S ribosomal protein S12 Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.confidentB2RLZ6
30S ribosomal protein S12 Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.confidentO70089

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022627 [CC]cytosolic small ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0034337 [BP]RNA foldingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0034336 [MF]misfolded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0033120 [BP]positive regulation of RNA splicingprobableGO:0043484, GO:0045935, GO:0010604, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051252, GO:0080090, GO:0051254, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0048522, GO:0010468, GO:0009893
GO:0000372 [BP]Group I intron splicingprobableGO:0016070, GO:0006139, GO:0044238, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0010467, GO:0044237, GO:0043170, GO:0090304, GO:0000375, GO:0000376, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0034641, GO:0008380, GO:0006396, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VQE, chain L
Confidence level:very confident
Coverage over the Query: 2-79
View the alignment between query and template
View the model in PyMOL