Query         psy16456
Match_columns 112
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Aug 16 21:46:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16456.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16456hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12287 Caprin-1_C:  Cytoplasm  10.2 2.3E+02   0.005   23.9   2.3   20   16-35    246-265 (316)
  2 PF12287 Caprin-1_C:  Cytoplasm   7.2 3.6E+02  0.0078   22.8   2.3   30    6-35    243-272 (316)
  3 cd00611 PSAT_like Phosphoserin   6.7 2.9E+02  0.0063   20.7   1.3   21   90-112   186-206 (355)
  4 cd01154 AidB Proteins involved   5.0 3.3E+02  0.0071   21.1   0.8   10  102-111   206-215 (418)
  5 PF01374 Glyco_hydro_46:  Glyco   4.7 2.8E+02   0.006   21.7   0.2   13    6-18     28-40  (215)
  6 TIGR01364 serC_1 phosphoserine   4.4 4.8E+02    0.01   19.9   1.3   21   90-112   178-198 (349)
  7 PRK05355 3-phosphoserine/phosp   4.3   5E+02   0.011   19.9   1.4   21   90-112   189-209 (360)
  8 TIGR01814 kynureninase kynuren   3.9 5.5E+02   0.012   19.3   1.3   14   91-105   227-240 (406)
  9 cd00978 chitosanase_glyco_hydr   3.8 3.6E+02  0.0079   21.3   0.2   13    6-18     38-50  (221)
 10 PRK11648 inner membrane protei   3.3 4.7E+02    0.01   20.0   0.4    6    4-9      70-75  (195)

No 1  
>PF12287 Caprin-1_C:  Cytoplasmic activation/proliferation-associated protein-1 C term;  InterPro: IPR022070  This family of proteins is found in eukaryotes. Proteins in this family are typically between 343 and 708 amino acids in length. This family is the C-terminal region of caprin-1. Caprin-1 is a protein involved in regulating cellular proliferation. In mutated phenotypes, the G1 phase of the cell cycle is greatly lengthened, impairing normal proliferation. The C-terminal region of caprin-1 contains RGG motifs which are characteristic of RNA binding domains. It is possible that caprin-1 functions through an RNA binding mechanism. 
Probab=10.22  E-value=2.3e+02  Score=23.87  Aligned_cols=20  Identities=45%  Similarity=0.836  Sum_probs=8.5

Q ss_pred             cccCCCCccCCCCCcccCCC
Q psy16456         16 TSGHRGLTSGHRGLTSGHRG   35 (112)
Q Consensus        16 tsghrgltsghrgltsghrg   35 (112)
                      .-|-|+|+.|-|+-+.|-||
T Consensus       246 ~Rg~R~l~NgYR~ps~Gykg  265 (316)
T PF12287_consen  246 PRGGRGLMNGYRGPSNGYKG  265 (316)
T ss_pred             CCCcccccccccCCCCCccC
Confidence            33344444444444344443


No 2  
>PF12287 Caprin-1_C:  Cytoplasmic activation/proliferation-associated protein-1 C term;  InterPro: IPR022070  This family of proteins is found in eukaryotes. Proteins in this family are typically between 343 and 708 amino acids in length. This family is the C-terminal region of caprin-1. Caprin-1 is a protein involved in regulating cellular proliferation. In mutated phenotypes, the G1 phase of the cell cycle is greatly lengthened, impairing normal proliferation. The C-terminal region of caprin-1 contains RGG motifs which are characteristic of RNA binding domains. It is possible that caprin-1 functions through an RNA binding mechanism. 
Probab=7.23  E-value=3.6e+02  Score=22.76  Aligned_cols=30  Identities=47%  Similarity=0.746  Sum_probs=14.4

Q ss_pred             CCcccCCCcccccCCCCccCCCCCcccCCC
Q psy16456          6 RGLTSGRRGLTSGHRGLTSGHRGLTSGHRG   35 (112)
Q Consensus         6 rgltsgrrgltsghrgltsghrgltsghrg   35 (112)
                      ||-.-|-|+|+.|-|+-+.|-||=-.|-||
T Consensus       243 RG~~Rg~R~l~NgYR~ps~GykgGfd~YRg  272 (316)
T PF12287_consen  243 RGGPRGGRGLMNGYRGPSNGYKGGFDGYRG  272 (316)
T ss_pred             cccCCCcccccccccCCCCCccCCcccccC
Confidence            344444455555555554455544444444


No 3  
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major group in this CD corresponds to phosphoserine aminotransferase (PSAT).  PSAT is active as a dimer and catalyzes the conversion of phosphohydroxypyruvate to phosphoserine.
Probab=6.70  E-value=2.9e+02  Score=20.70  Aligned_cols=21  Identities=29%  Similarity=0.468  Sum_probs=14.9

Q ss_pred             cccccCCccccccCccceeeecC
Q psy16456         90 RALTSGHKTLTSGHRGLTSFIIS  112 (112)
Q Consensus        90 raltsghktltsghrgltsfiis  112 (112)
                      -+.+++||.+  |-.|+.-++++
T Consensus       186 ~~~ss~~K~l--GP~G~g~l~~~  206 (355)
T cd00611         186 VIYAGAQKNL--GPAGVTVVIVR  206 (355)
T ss_pred             EEEeeccccc--CCCceEEEEEC
Confidence            3677799965  57788766653


No 4  
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product. AidB is one of several genes involved in the SOS adaptive response to DNA alkylation damage, whose expression is activated by the Ada protein. Its function has not been entirely elucidated; however, it is similar in sequence and function to acyl-CoA dehydrogenases. It has been proposed that aidB directly destroys DNA alkylating agents such as nitrosoguanidines (nitrosated amides) or their reaction intermediates.
Probab=4.95  E-value=3.3e+02  Score=21.13  Aligned_cols=10  Identities=50%  Similarity=1.112  Sum_probs=7.3

Q ss_pred             cCccceeeec
Q psy16456        102 GHRGLTSFII  111 (112)
Q Consensus       102 ghrgltsfii  111 (112)
                      +|+|++.|++
T Consensus       206 ~~~gls~flV  215 (418)
T cd01154         206 GARGLSLFLV  215 (418)
T ss_pred             CCCcEEEEEE
Confidence            5678887775


No 5  
>PF01374 Glyco_hydro_46:  Glycosyl hydrolase family 46;  InterPro: IPR000400 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 46 GH46 from CAZY comprises enzymes with only one known activity; chitosanase (3.2.1.132 from EC). Chitosanase enzymes catalyse the endohydrolysis of beta-1,4-linkages between N-acetyl-D-glucosamine and D-glucosamine residues in a partly acetylated chitosan.; GO: 0016977 chitosanase activity, 0005975 carbohydrate metabolic process, 0005576 extracellular region; PDB: 1QGI_A 2D05_A 1CHK_B.
Probab=4.70  E-value=2.8e+02  Score=21.72  Aligned_cols=13  Identities=46%  Similarity=0.843  Sum_probs=5.0

Q ss_pred             CCcccCCCccccc
Q psy16456          6 RGLTSGRRGLTSG   18 (112)
Q Consensus         6 rgltsgrrgltsg   18 (112)
                      ||.|.|+-|.|+|
T Consensus        28 RGyT~Gi~Gf~tG   40 (215)
T PF01374_consen   28 RGYTAGIIGFCTG   40 (215)
T ss_dssp             S-EEETTTTEETT
T ss_pred             CCcceeeeeeecC
Confidence            3444444444443


No 6  
>TIGR01364 serC_1 phosphoserine aminotransferase. This model represents the common form of the phosphoserine aminotransferase SerC. The phosphoserine aminotransferase of the archaeon Methanosarcina barkeri and putative phosphoserine aminotransferase of Mycobacterium tuberculosis are represented by separate models. All are members of the class V aminotransferases (pfam00266).
Probab=4.42  E-value=4.8e+02  Score=19.95  Aligned_cols=21  Identities=29%  Similarity=0.480  Sum_probs=15.2

Q ss_pred             cccccCCccccccCccceeeecC
Q psy16456         90 RALTSGHKTLTSGHRGLTSFIIS  112 (112)
Q Consensus        90 raltsghktltsghrgltsfiis  112 (112)
                      -..+|+||.+  |-.|+.-++++
T Consensus       178 ~~~~ssqK~l--gP~Glg~l~~s  198 (349)
T TIGR01364       178 LIYAGAQKNI--GPAGLTVVIVR  198 (349)
T ss_pred             EEEEeccccc--CCCceEEEEEC
Confidence            6678999987  46687766654


No 7  
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional
Probab=4.35  E-value=5e+02  Score=19.87  Aligned_cols=21  Identities=29%  Similarity=0.468  Sum_probs=15.4

Q ss_pred             cccccCCccccccCccceeeecC
Q psy16456         90 RALTSGHKTLTSGHRGLTSFIIS  112 (112)
Q Consensus        90 raltsghktltsghrgltsfiis  112 (112)
                      -..+|+||.+  |-.|+.-++++
T Consensus       189 ~~~~ssqK~l--gP~Glg~l~~s  209 (360)
T PRK05355        189 LIYAGAQKNI--GPAGLTIVIVR  209 (360)
T ss_pred             EEEEeccccc--cCCceEEEEEC
Confidence            5678999987  46788766654


No 8  
>TIGR01814 kynureninase kynureninase. This model describes kynureninase, a pyridoxal-phosphate enzyme. Kynurinine is a Trp breakdown product and a precursor for NAD. In Chlamydia psittaci, an obligate intracellular pathogen, kynureninase makes anthranilate, a Trp precursor, from kynurenine. This counters the tryptophan hydrolysis that occurs in the host cell in response to the pathogen.
Probab=3.91  E-value=5.5e+02  Score=19.30  Aligned_cols=14  Identities=36%  Similarity=0.316  Sum_probs=10.5

Q ss_pred             ccccCCccccccCcc
Q psy16456         91 ALTSGHKTLTSGHRG  105 (112)
Q Consensus        91 altsghktltsghrg  105 (112)
                      ...|+||+|-.+. |
T Consensus       227 ~~~s~hK~l~g~p-G  240 (406)
T TIGR01814       227 ACWCTYKYLNAGP-G  240 (406)
T ss_pred             EEEcCccccCCCC-C
Confidence            4478999987765 5


No 9  
>cd00978 chitosanase_glyco_hydro_46 Glycosyl hydrolase family 46 chitosanase domain. This family are composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked -D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases who members are the most prevalent can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan.  Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.
Probab=3.82  E-value=3.6e+02  Score=21.35  Aligned_cols=13  Identities=46%  Similarity=0.843  Sum_probs=0.0

Q ss_pred             CCcccCCCccccc
Q psy16456          6 RGLTSGRRGLTSG   18 (112)
Q Consensus         6 rgltsgrrgltsg   18 (112)
                      ||+|-|+.|.|||
T Consensus        38 rGyT~Gi~G~tsG   50 (221)
T cd00978          38 RGYTAGIIGFCTG   50 (221)
T ss_pred             CCceeeeeeeeCC


No 10 
>PRK11648 inner membrane protein; Provisional
Probab=3.29  E-value=4.7e+02  Score=19.99  Aligned_cols=6  Identities=83%  Similarity=1.575  Sum_probs=0.0

Q ss_pred             CCCCcc
Q psy16456          4 GHRGLT    9 (112)
Q Consensus         4 ghrglt    9 (112)
                      ||||+|
T Consensus        70 gHRG~T   75 (195)
T PRK11648         70 GHRGFT   75 (195)
T ss_pred             CCCcch


Done!