Query psy16456
Match_columns 112
No_of_seqs 1 out of 3
Neff 1.0
Searched_HMMs 46136
Date Fri Aug 16 21:46:39 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy16456.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16456hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF12287 Caprin-1_C: Cytoplasm 10.2 2.3E+02 0.005 23.9 2.3 20 16-35 246-265 (316)
2 PF12287 Caprin-1_C: Cytoplasm 7.2 3.6E+02 0.0078 22.8 2.3 30 6-35 243-272 (316)
3 cd00611 PSAT_like Phosphoserin 6.7 2.9E+02 0.0063 20.7 1.3 21 90-112 186-206 (355)
4 cd01154 AidB Proteins involved 5.0 3.3E+02 0.0071 21.1 0.8 10 102-111 206-215 (418)
5 PF01374 Glyco_hydro_46: Glyco 4.7 2.8E+02 0.006 21.7 0.2 13 6-18 28-40 (215)
6 TIGR01364 serC_1 phosphoserine 4.4 4.8E+02 0.01 19.9 1.3 21 90-112 178-198 (349)
7 PRK05355 3-phosphoserine/phosp 4.3 5E+02 0.011 19.9 1.4 21 90-112 189-209 (360)
8 TIGR01814 kynureninase kynuren 3.9 5.5E+02 0.012 19.3 1.3 14 91-105 227-240 (406)
9 cd00978 chitosanase_glyco_hydr 3.8 3.6E+02 0.0079 21.3 0.2 13 6-18 38-50 (221)
10 PRK11648 inner membrane protei 3.3 4.7E+02 0.01 20.0 0.4 6 4-9 70-75 (195)
No 1
>PF12287 Caprin-1_C: Cytoplasmic activation/proliferation-associated protein-1 C term; InterPro: IPR022070 This family of proteins is found in eukaryotes. Proteins in this family are typically between 343 and 708 amino acids in length. This family is the C-terminal region of caprin-1. Caprin-1 is a protein involved in regulating cellular proliferation. In mutated phenotypes, the G1 phase of the cell cycle is greatly lengthened, impairing normal proliferation. The C-terminal region of caprin-1 contains RGG motifs which are characteristic of RNA binding domains. It is possible that caprin-1 functions through an RNA binding mechanism.
Probab=10.22 E-value=2.3e+02 Score=23.87 Aligned_cols=20 Identities=45% Similarity=0.836 Sum_probs=8.5
Q ss_pred cccCCCCccCCCCCcccCCC
Q psy16456 16 TSGHRGLTSGHRGLTSGHRG 35 (112)
Q Consensus 16 tsghrgltsghrgltsghrg 35 (112)
.-|-|+|+.|-|+-+.|-||
T Consensus 246 ~Rg~R~l~NgYR~ps~Gykg 265 (316)
T PF12287_consen 246 PRGGRGLMNGYRGPSNGYKG 265 (316)
T ss_pred CCCcccccccccCCCCCccC
Confidence 33344444444444344443
No 2
>PF12287 Caprin-1_C: Cytoplasmic activation/proliferation-associated protein-1 C term; InterPro: IPR022070 This family of proteins is found in eukaryotes. Proteins in this family are typically between 343 and 708 amino acids in length. This family is the C-terminal region of caprin-1. Caprin-1 is a protein involved in regulating cellular proliferation. In mutated phenotypes, the G1 phase of the cell cycle is greatly lengthened, impairing normal proliferation. The C-terminal region of caprin-1 contains RGG motifs which are characteristic of RNA binding domains. It is possible that caprin-1 functions through an RNA binding mechanism.
Probab=7.23 E-value=3.6e+02 Score=22.76 Aligned_cols=30 Identities=47% Similarity=0.746 Sum_probs=14.4
Q ss_pred CCcccCCCcccccCCCCccCCCCCcccCCC
Q psy16456 6 RGLTSGRRGLTSGHRGLTSGHRGLTSGHRG 35 (112)
Q Consensus 6 rgltsgrrgltsghrgltsghrgltsghrg 35 (112)
||-.-|-|+|+.|-|+-+.|-||=-.|-||
T Consensus 243 RG~~Rg~R~l~NgYR~ps~GykgGfd~YRg 272 (316)
T PF12287_consen 243 RGGPRGGRGLMNGYRGPSNGYKGGFDGYRG 272 (316)
T ss_pred cccCCCcccccccccCCCCCccCCcccccC
Confidence 344444455555555554455544444444
No 3
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major group in this CD corresponds to phosphoserine aminotransferase (PSAT). PSAT is active as a dimer and catalyzes the conversion of phosphohydroxypyruvate to phosphoserine.
Probab=6.70 E-value=2.9e+02 Score=20.70 Aligned_cols=21 Identities=29% Similarity=0.468 Sum_probs=14.9
Q ss_pred cccccCCccccccCccceeeecC
Q psy16456 90 RALTSGHKTLTSGHRGLTSFIIS 112 (112)
Q Consensus 90 raltsghktltsghrgltsfiis 112 (112)
-+.+++||.+ |-.|+.-++++
T Consensus 186 ~~~ss~~K~l--GP~G~g~l~~~ 206 (355)
T cd00611 186 VIYAGAQKNL--GPAGVTVVIVR 206 (355)
T ss_pred EEEeeccccc--CCCceEEEEEC
Confidence 3677799965 57788766653
No 4
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product. AidB is one of several genes involved in the SOS adaptive response to DNA alkylation damage, whose expression is activated by the Ada protein. Its function has not been entirely elucidated; however, it is similar in sequence and function to acyl-CoA dehydrogenases. It has been proposed that aidB directly destroys DNA alkylating agents such as nitrosoguanidines (nitrosated amides) or their reaction intermediates.
Probab=4.95 E-value=3.3e+02 Score=21.13 Aligned_cols=10 Identities=50% Similarity=1.112 Sum_probs=7.3
Q ss_pred cCccceeeec
Q psy16456 102 GHRGLTSFII 111 (112)
Q Consensus 102 ghrgltsfii 111 (112)
+|+|++.|++
T Consensus 206 ~~~gls~flV 215 (418)
T cd01154 206 GARGLSLFLV 215 (418)
T ss_pred CCCcEEEEEE
Confidence 5678887775
No 5
>PF01374 Glyco_hydro_46: Glycosyl hydrolase family 46; InterPro: IPR000400 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 46 GH46 from CAZY comprises enzymes with only one known activity; chitosanase (3.2.1.132 from EC). Chitosanase enzymes catalyse the endohydrolysis of beta-1,4-linkages between N-acetyl-D-glucosamine and D-glucosamine residues in a partly acetylated chitosan.; GO: 0016977 chitosanase activity, 0005975 carbohydrate metabolic process, 0005576 extracellular region; PDB: 1QGI_A 2D05_A 1CHK_B.
Probab=4.70 E-value=2.8e+02 Score=21.72 Aligned_cols=13 Identities=46% Similarity=0.843 Sum_probs=5.0
Q ss_pred CCcccCCCccccc
Q psy16456 6 RGLTSGRRGLTSG 18 (112)
Q Consensus 6 rgltsgrrgltsg 18 (112)
||.|.|+-|.|+|
T Consensus 28 RGyT~Gi~Gf~tG 40 (215)
T PF01374_consen 28 RGYTAGIIGFCTG 40 (215)
T ss_dssp S-EEETTTTEETT
T ss_pred CCcceeeeeeecC
Confidence 3444444444443
No 6
>TIGR01364 serC_1 phosphoserine aminotransferase. This model represents the common form of the phosphoserine aminotransferase SerC. The phosphoserine aminotransferase of the archaeon Methanosarcina barkeri and putative phosphoserine aminotransferase of Mycobacterium tuberculosis are represented by separate models. All are members of the class V aminotransferases (pfam00266).
Probab=4.42 E-value=4.8e+02 Score=19.95 Aligned_cols=21 Identities=29% Similarity=0.480 Sum_probs=15.2
Q ss_pred cccccCCccccccCccceeeecC
Q psy16456 90 RALTSGHKTLTSGHRGLTSFIIS 112 (112)
Q Consensus 90 raltsghktltsghrgltsfiis 112 (112)
-..+|+||.+ |-.|+.-++++
T Consensus 178 ~~~~ssqK~l--gP~Glg~l~~s 198 (349)
T TIGR01364 178 LIYAGAQKNI--GPAGLTVVIVR 198 (349)
T ss_pred EEEEeccccc--CCCceEEEEEC
Confidence 6678999987 46687766654
No 7
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional
Probab=4.35 E-value=5e+02 Score=19.87 Aligned_cols=21 Identities=29% Similarity=0.468 Sum_probs=15.4
Q ss_pred cccccCCccccccCccceeeecC
Q psy16456 90 RALTSGHKTLTSGHRGLTSFIIS 112 (112)
Q Consensus 90 raltsghktltsghrgltsfiis 112 (112)
-..+|+||.+ |-.|+.-++++
T Consensus 189 ~~~~ssqK~l--gP~Glg~l~~s 209 (360)
T PRK05355 189 LIYAGAQKNI--GPAGLTIVIVR 209 (360)
T ss_pred EEEEeccccc--cCCceEEEEEC
Confidence 5678999987 46788766654
No 8
>TIGR01814 kynureninase kynureninase. This model describes kynureninase, a pyridoxal-phosphate enzyme. Kynurinine is a Trp breakdown product and a precursor for NAD. In Chlamydia psittaci, an obligate intracellular pathogen, kynureninase makes anthranilate, a Trp precursor, from kynurenine. This counters the tryptophan hydrolysis that occurs in the host cell in response to the pathogen.
Probab=3.91 E-value=5.5e+02 Score=19.30 Aligned_cols=14 Identities=36% Similarity=0.316 Sum_probs=10.5
Q ss_pred ccccCCccccccCcc
Q psy16456 91 ALTSGHKTLTSGHRG 105 (112)
Q Consensus 91 altsghktltsghrg 105 (112)
...|+||+|-.+. |
T Consensus 227 ~~~s~hK~l~g~p-G 240 (406)
T TIGR01814 227 ACWCTYKYLNAGP-G 240 (406)
T ss_pred EEEcCccccCCCC-C
Confidence 4478999987765 5
No 9
>cd00978 chitosanase_glyco_hydro_46 Glycosyl hydrolase family 46 chitosanase domain. This family are composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked -D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases who members are the most prevalent can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.
Probab=3.82 E-value=3.6e+02 Score=21.35 Aligned_cols=13 Identities=46% Similarity=0.843 Sum_probs=0.0
Q ss_pred CCcccCCCccccc
Q psy16456 6 RGLTSGRRGLTSG 18 (112)
Q Consensus 6 rgltsgrrgltsg 18 (112)
||+|-|+.|.|||
T Consensus 38 rGyT~Gi~G~tsG 50 (221)
T cd00978 38 RGYTAGIIGFCTG 50 (221)
T ss_pred CCceeeeeeeeCC
No 10
>PRK11648 inner membrane protein; Provisional
Probab=3.29 E-value=4.7e+02 Score=19.99 Aligned_cols=6 Identities=83% Similarity=1.575 Sum_probs=0.0
Q ss_pred CCCCcc
Q psy16456 4 GHRGLT 9 (112)
Q Consensus 4 ghrglt 9 (112)
||||+|
T Consensus 70 gHRG~T 75 (195)
T PRK11648 70 GHRGFT 75 (195)
T ss_pred CCCcch
Done!