Query         psy16466
Match_columns 101
No_of_seqs    67 out of 69
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 22:03:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16466.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16466hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2966|consensus               99.5 7.7E-15 1.7E-19  120.3   3.0   58    2-66    261-318 (325)
  2 PF04678 DUF607:  Protein of un  98.5 7.6E-08 1.6E-12   71.6   2.8   35    2-36    146-180 (180)
  3 PF05713 MobC:  Bacterial mobil  58.0      28 0.00061   20.6   4.1   27   25-51     22-48  (48)
  4 PF15079 DUF4546:  Domain of un  48.4      12 0.00026   29.7   1.7   14   34-47     51-64  (205)
  5 TIGR01004 PulS_OutS lipoprotei  48.0      35 0.00077   25.3   4.0   52    2-53     54-106 (128)
  6 PF08285 DPM3:  Dolichol-phosph  47.2      19 0.00041   24.8   2.4   19   30-48     68-86  (91)
  7 COG4064 MtrG Tetrahydromethano  43.1      28 0.00061   24.0   2.6   28   21-48      6-33  (75)
  8 PF12535 Nudix_N:  Hydrolase of  41.5     8.3 0.00018   24.6  -0.1   19   24-42     23-41  (58)
  9 KOG2712|consensus               40.5      31 0.00068   25.1   2.7   24   26-49     82-105 (108)
 10 PF04201 TPD52:  Tumour protein  39.6      35 0.00075   26.3   3.0   30   25-54     24-53  (162)
 11 PF13767 DUF4168:  Domain of un  37.1      29 0.00063   22.4   2.0   25   21-46     50-74  (78)
 12 PF06305 DUF1049:  Protein of u  35.5      36 0.00079   20.7   2.1   19   32-50     50-68  (68)
 13 cd04766 HTH_HspR Helix-Turn-He  33.0      31 0.00067   22.5   1.6   40   15-54     47-89  (91)
 14 KOG0862|consensus               30.8      73  0.0016   25.6   3.6   36   63-98     13-51  (216)
 15 PF04977 DivIC:  Septum formati  30.6      51  0.0011   20.2   2.2   21   32-52     33-54  (80)
 16 PF06698 DUF1192:  Protein of u  30.5      51  0.0011   21.4   2.2   27   27-53     16-44  (59)
 17 PF04912 Dynamitin:  Dynamitin   29.2      51  0.0011   27.1   2.6   24   28-51     92-115 (388)
 18 PF13422 DUF4110:  Domain of un  28.7      32 0.00069   24.0   1.2   29   20-48     44-74  (96)
 19 smart00040 CSF2 Granulocyte-ma  27.8      26 0.00057   26.0   0.6   65   25-89     45-115 (121)
 20 KOG4098|consensus               27.3      63  0.0014   24.6   2.6   24   28-51     20-43  (140)
 21 COG1102 Cmk Cytidylate kinase   27.2      53  0.0012   25.8   2.2   30   16-45     33-62  (179)
 22 PF09006 Surfac_D-trimer:  Lung  26.9      69  0.0015   20.2   2.3   22   33-54      2-23  (46)
 23 PRK11020 hypothetical protein;  26.1      70  0.0015   23.7   2.6   61   22-83     23-88  (118)
 24 cd00040 CSF2 Granulocyte Macro  26.1      28 0.00061   25.8   0.5   65   25-89     45-115 (121)
 25 PF06569 DUF1128:  Protein of u  26.0      75  0.0016   21.5   2.5   27   24-50     30-70  (71)
 26 PF11461 RILP:  Rab interacting  25.8      71  0.0015   20.9   2.3   25   30-54     10-34  (60)
 27 PF12022 DUF3510:  Domain of un  25.7      74  0.0016   22.5   2.6   22   31-52     78-99  (125)
 28 PF09862 DUF2089:  Protein of u  25.2      94   0.002   22.4   3.1   19    4-27     61-79  (113)
 29 PF08663 HalX:  HalX domain;  I  24.0      81  0.0017   20.8   2.4   26   28-53     34-59  (71)
 30 PF08802 CytB6-F_Fe-S:  Cytochr  23.7      58  0.0013   19.7   1.5   14    6-19      3-16  (39)
 31 PF07443 HARP:  HepA-related pr  23.1      37  0.0008   21.8   0.6   21   21-41     26-46  (55)
 32 PF04210 MtrG:  Tetrahydrometha  22.8      90   0.002   21.2   2.4   23   26-48      8-30  (70)
 33 TIGR01837 PHA_granule_1 poly(h  22.7      91   0.002   21.9   2.6   22   30-51     96-117 (118)
 34 PF07334 IFP_35_N:  Interferon-  22.4      67  0.0015   21.9   1.8   23   34-56     11-33  (76)
 35 TIGR03782 Bac_Flav_CT_J Bacter  22.0      62  0.0013   27.4   1.9   34   17-54     89-122 (322)
 36 PF01920 Prefoldin_2:  Prefoldi  20.9 1.2E+02  0.0025   19.5   2.7   21   30-50      5-25  (106)
 37 PF12652 CotJB:  CotJB protein;  20.8 1.3E+02  0.0028   20.2   2.9   26   29-54     32-57  (78)

No 1  
>KOG2966|consensus
Probab=99.50  E-value=7.7e-15  Score=120.25  Aligned_cols=58  Identities=34%  Similarity=0.446  Sum_probs=56.2

Q ss_pred             cccCcchhhHHHHHHHHHhhhhccCCChhhhhhhhhHHHHHHHHHHhhhCCCCCCCCCccccccC
Q psy16466          2 MEYYLPDVRDRQFLIHLHKRAKKVGFPLEQYNCLKNECGKLENDLARLRDPLIPPYRGYEFQVPS   66 (101)
Q Consensus         2 QdY~Yp~ardRq~L~~FHK~Akk~~FDVe~YN~LKeelA~vEedLkRLRdPL~l~~~~~~~~~p~   66 (101)
                      |||+||.+++|+|+.+|||.+++++|||++||+||+..+....+++|.|||+.       +|+|.
T Consensus       261 qepsy~~~~~r~f~~kq~Kl~k~~~FDierYneLk~~~~~~~~~~~~~~~~l~-------~~~~v  318 (325)
T KOG2966|consen  261 QEPSYEGFYKRRFLTKQRKLMKKQDFDIERYNELKKLFAPAPCSLKRCRDPLF-------QHLPV  318 (325)
T ss_pred             cCcccHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHhhCccccccccccHH-------hcCch
Confidence            89999999999999999999999999999999999999999999999999999       77776


No 2  
>PF04678 DUF607:  Protein of unknown function, DUF607;  InterPro: IPR006769 This entry represents the C-terminal domain of coiled-coil domain containing protein 109.
Probab=98.49  E-value=7.6e-08  Score=71.57  Aligned_cols=35  Identities=46%  Similarity=0.618  Sum_probs=34.0

Q ss_pred             cccCcchhhHHHHHHHHHhhhhccCCChhhhhhhh
Q psy16466          2 MEYYLPDVRDRQFLIHLHKRAKKVGFPLEQYNCLK   36 (101)
Q Consensus         2 QdY~Yp~ardRq~L~~FHK~Akk~~FDVe~YN~LK   36 (101)
                      +||.|+++.+|.++.++||.+++++||+++||+||
T Consensus       146 re~sy~~~~~~~~~~~~~kl~~~~~fD~~~y~~L~  180 (180)
T PF04678_consen  146 REYSYESVFQRRFLRRQHKLYAKHGFDIERYNELK  180 (180)
T ss_pred             CCCChHHHHHHHHHHHHHHHHHHcCCCHHHHHhcC
Confidence            69999999999999999999999999999999996


No 3  
>PF05713 MobC:  Bacterial mobilisation protein (MobC);  InterPro: IPR008687 This family consists of several bacterial MobC-like, mobilisation proteins. MobC proteins belong to the group of relaxases. Together with MobA and MobB they bind to a single cis-active site of a mobilising plasmid, the origin of transfer (oriT) region []. The absence of MobC has several different effects on oriT DNA. Site- and strand-specific nicking by MobA protein is severely reduced, accounting for the lower frequency of mobilisation. The localised DNA strand separation required for this nicking is less affected, but becomes more sensitive to the level of active DNA gyrase in the cell. In addition, strand separation is not efficiently extended through the region containing the nick site. These effects suggest a model in which MobC acts as a molecular wedge for the relaxosome-induced melting of oriT DNA. The effect of MobC on strand separation may be partially complemented by the helical distortion induced by supercoiling. However, MobC extends the melted region through the nick site, thus providing the single-stranded substrate required for cleavage by MobA [].
Probab=58.02  E-value=28  Score=20.60  Aligned_cols=27  Identities=30%  Similarity=0.421  Sum_probs=23.1

Q ss_pred             cCCChhhhhhhhhHHHHHHHHHHhhhC
Q psy16466         25 VGFPLEQYNCLKNECGKLENDLARLRD   51 (101)
Q Consensus        25 ~~FDVe~YN~LKeelA~vEedLkRLRd   51 (101)
                      .+++...+=++.+++.++...|++|||
T Consensus        22 ~~~~~~~~~~~~~~L~~i~~~L~~l~~   48 (48)
T PF05713_consen   22 GQVDEQEYEKLIEELREIEKELKELRD   48 (48)
T ss_pred             CCCcHHHHHHHHHHHHHHHHHHHHHHC
Confidence            567777777788999999999999986


No 4  
>PF15079 DUF4546:  Domain of unknown function (DUF4546)
Probab=48.36  E-value=12  Score=29.73  Aligned_cols=14  Identities=36%  Similarity=0.470  Sum_probs=8.9

Q ss_pred             hhhhHHHHHHHHHH
Q psy16466         34 CLKNECGKLENDLA   47 (101)
Q Consensus        34 ~LKeelA~vEedLk   47 (101)
                      +||.++.+|.|+|+
T Consensus        51 eLkNeLREVREELk   64 (205)
T PF15079_consen   51 ELKNELREVREELK   64 (205)
T ss_pred             HHHHHHHHHHHHHH
Confidence            56666666666665


No 5  
>TIGR01004 PulS_OutS lipoprotein, PulS/OutS family. This family comprises lipoproteins from four gamma proteobacterial species: PulS protein of Klebsiella pneumoniae, the OutS protein of Erwinia chrysanthemi and Pectobacterium chrysanthemi, and the functionally uncharacterized E. coli protein EtpO. PulS and OutS have been shown to interact with and facilitate insertion of secretins into the outer membrane, suggesting a chaperone-like, or piloting function for members of this family.
Probab=48.01  E-value=35  Score=25.35  Aligned_cols=52  Identities=19%  Similarity=0.179  Sum_probs=40.9

Q ss_pred             cccCcchhhHHH-HHHHHHhhhhccCCChhhhhhhhhHHHHHHHHHHhhhCCC
Q psy16466          2 MEYYLPDVRDRQ-FLIHLHKRAKKVGFPLEQYNCLKNECGKLENDLARLRDPL   53 (101)
Q Consensus         2 QdY~Yp~ardRq-~L~~FHK~Akk~~FDVe~YN~LKeelA~vEedLkRLRdPL   53 (101)
                      ++.-|.++-|++ -....=+-|+.+|.|+..||.|+..-.+.=.+|++..-|-
T Consensus        54 ~~C~rsdiPd~~~I~raai~~A~~~gWd~~~y~~l~~~se~~Yq~L~~d~~p~  106 (128)
T TIGR01004        54 MQCNRSDLPDDGSILKTANNVAIGKGWDSGRQEDLPQHSDDLYQGLLKDSTPE  106 (128)
T ss_pred             hcCCcccCCcHHHHHHHHHHHHHHcCCchhhHHHHHHHHHHHHHHHhccCCcc
Confidence            356678888888 7777788899999999999988877777777777655554


No 6  
>PF08285 DPM3:  Dolichol-phosphate mannosyltransferase subunit 3 (DPM3);  InterPro: IPR013174 This family corresponds to subunit 3 of dolichol-phosphate mannosyltransferase, an enzyme which generates mannosyl donors for glycosylphosphatidylinositols, N-glycan and protein O- and C-mannosylation. DPM3 is an integral membrane protein and plays a role in stabilising the dolichol-phosphate mannosyl transferase complex [].
Probab=47.24  E-value=19  Score=24.81  Aligned_cols=19  Identities=26%  Similarity=0.324  Sum_probs=16.8

Q ss_pred             hhhhhhhhHHHHHHHHHHh
Q psy16466         30 EQYNCLKNECGKLENDLAR   48 (101)
Q Consensus        30 e~YN~LKeelA~vEedLkR   48 (101)
                      |.|-+|..|+.++++||++
T Consensus        68 eA~~eL~~eI~eAK~dLr~   86 (91)
T PF08285_consen   68 EAAKELQKEIKEAKADLRK   86 (91)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4588999999999999986


No 7  
>COG4064 MtrG Tetrahydromethanopterin S-methyltransferase, subunit G [Coenzyme metabolism]
Probab=43.08  E-value=28  Score=23.95  Aligned_cols=28  Identities=14%  Similarity=0.274  Sum_probs=23.5

Q ss_pred             hhhccCCChhhhhhhhhHHHHHHHHHHh
Q psy16466         21 RAKKVGFPLEQYNCLKNECGKLENDLAR   48 (101)
Q Consensus        21 ~Akk~~FDVe~YN~LKeelA~vEedLkR   48 (101)
                      ++.+.-.|-+.||+++.++.++|+.+.-
T Consensus         6 k~P~v~v~~~dfne~~kRLdeieekvef   33 (75)
T COG4064           6 KVPKVVVDPDDFNEIHKRLDEIEEKVEF   33 (75)
T ss_pred             cCCccccCHHHHHHHHHHHHHHHHHHHh
Confidence            3566778899999999999999998753


No 8  
>PF12535 Nudix_N:  Hydrolase of X-linked nucleoside diphosphate N terminal ; PDB: 3Q1P_B 3Q4I_B.
Probab=41.49  E-value=8.3  Score=24.57  Aligned_cols=19  Identities=26%  Similarity=0.401  Sum_probs=14.1

Q ss_pred             ccCCChhhhhhhhhHHHHH
Q psy16466         24 KVGFPLEQYNCLKNECGKL   42 (101)
Q Consensus        24 k~~FDVe~YN~LKeelA~v   42 (101)
                      +..||+|+|.+|++=.+++
T Consensus        23 kd~yD~ERy~~lr~ia~el   41 (58)
T PF12535_consen   23 KDPYDRERYEELREIAAEL   41 (58)
T ss_dssp             --HHHHHHHHHHHHHHHHH
T ss_pred             CChhhHHHHHHHHHHHHHH
Confidence            5679999999998766654


No 9  
>KOG2712|consensus
Probab=40.51  E-value=31  Score=25.10  Aligned_cols=24  Identities=29%  Similarity=0.545  Sum_probs=21.7

Q ss_pred             CCChhhhhhhhhHHHHHHHHHHhh
Q psy16466         26 GFPLEQYNCLKNECGKLENDLARL   49 (101)
Q Consensus        26 ~FDVe~YN~LKeelA~vEedLkRL   49 (101)
                      .+.+++||.||+-+.+++..|++|
T Consensus        82 SLs~~qW~~Lk~~~~eId~Al~~l  105 (108)
T KOG2712|consen   82 SLSLEQWSKLKEHIEEIDKALRKL  105 (108)
T ss_pred             ccCHHHHHHHHHHHHHHHHHHHHh
Confidence            467899999999999999999987


No 10 
>PF04201 TPD52:  Tumour protein D52 family;  InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologues from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologues of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family []. These proteins have an N-terminal coiled-coil that allows members to form homo- and heterodimers with each other [].
Probab=39.64  E-value=35  Score=26.25  Aligned_cols=30  Identities=30%  Similarity=0.462  Sum_probs=25.4

Q ss_pred             cCCChhhhhhhhhHHHHHHHHHHhhhCCCC
Q psy16466         25 VGFPLEQYNCLKNECGKLENDLARLRDPLI   54 (101)
Q Consensus        25 ~~FDVe~YN~LKeelA~vEedLkRLRdPL~   54 (101)
                      ..+.-+.--+|+.+|+++|+++.-||.-|.
T Consensus        24 ~~LsEeE~eeLr~EL~KvEeEI~TLrqvL~   53 (162)
T PF04201_consen   24 EGLSEEEREELRSELAKVEEEIQTLRQVLA   53 (162)
T ss_pred             ccCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            566667788999999999999999997654


No 11 
>PF13767 DUF4168:  Domain of unknown function (DUF4168)
Probab=37.11  E-value=29  Score=22.35  Aligned_cols=25  Identities=16%  Similarity=0.432  Sum_probs=17.3

Q ss_pred             hhhccCCChhhhhhhhhHHHHHHHHH
Q psy16466         21 RAKKVGFPLEQYNCLKNECGKLENDL   46 (101)
Q Consensus        21 ~Akk~~FDVe~YN~LKeelA~vEedL   46 (101)
                      .-...|++|++||++-..+ +-..+|
T Consensus        50 ~I~~~GLtv~~fN~I~~~~-q~Dp~L   74 (78)
T PF13767_consen   50 AIEENGLTVERFNEITQAA-QSDPEL   74 (78)
T ss_pred             HHHHcCCCHHHHHHHHHHH-HcCHHH
Confidence            3467899999999995543 444444


No 12 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=35.49  E-value=36  Score=20.71  Aligned_cols=19  Identities=42%  Similarity=0.604  Sum_probs=14.0

Q ss_pred             hhhhhhHHHHHHHHHHhhh
Q psy16466         32 YNCLKNECGKLENDLARLR   50 (101)
Q Consensus        32 YN~LKeelA~vEedLkRLR   50 (101)
                      .-+++.+++++|.++..||
T Consensus        50 ~~~~~k~l~~le~e~~~lr   68 (68)
T PF06305_consen   50 IRRLRKELKKLEKELEQLR   68 (68)
T ss_pred             HHHHHHHHHHHHHHHHhcC
Confidence            4466778888888887776


No 13 
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator. Helix-turn-helix (HTH) transcription regulator HspR, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain  with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=33.02  E-value=31  Score=22.48  Aligned_cols=40  Identities=25%  Similarity=0.387  Sum_probs=28.7

Q ss_pred             HHHHHhhhhccCCChh---hhhhhhhHHHHHHHHHHhhhCCCC
Q psy16466         15 LIHLHKRAKKVGFPLE---QYNCLKNECGKLENDLARLRDPLI   54 (101)
Q Consensus        15 L~~FHK~Akk~~FDVe---~YN~LKeelA~vEedLkRLRdPL~   54 (101)
                      |.+...-....||+++   .+=.|++++..++.+|.+||.-|+
T Consensus        47 l~~i~~L~~d~g~~l~~i~~~l~l~~~~~~l~~~l~~l~~~~~   89 (91)
T cd04766          47 LRRIQRLTQELGVNLAGVKRILELEEELAELRAELDELRARLR   89 (91)
T ss_pred             HHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            4444444444777654   566799999999999999987664


No 14 
>KOG0862|consensus
Probab=30.76  E-value=73  Score=25.56  Aligned_cols=36  Identities=19%  Similarity=0.332  Sum_probs=25.6

Q ss_pred             cccC--ccc-ccccCchhHhhHHHHHHHHHhhcCCCCCC
Q psy16466         63 QVPS--DLS-YKQPSSSINKFKEQIKMILSKQSHGANKN   98 (101)
Q Consensus        63 ~~p~--~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (101)
                      .||+  ..+ .-++..++.+.|.|+|+|..+-..++-.+
T Consensus        13 GLPLa~s~d~~e~~~~s~~e~r~q~K~L~kkLs~~s~~r   51 (216)
T KOG0862|consen   13 GLPLAASTDDNEQSGDSLLEYRQQAKSLFKKLSQQSPTR   51 (216)
T ss_pred             CcccccccCcccCCCchHHHHHHHHHHHHHhccCCCCcc
Confidence            4677  344 44455566888999999999887775444


No 15 
>PF04977 DivIC:  Septum formation initiator;  InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation []. These proteins are mainly composed of an N-terminal coiled-coil. DivIB, DivIC and FtsL inter-depend on each other for stabilisation and localisation. The latter two form a heterodimer. DivIC is always centre cell but the other two associate with it during septation [].; GO: 0007049 cell cycle
Probab=30.56  E-value=51  Score=20.22  Aligned_cols=21  Identities=38%  Similarity=0.640  Sum_probs=11.2

Q ss_pred             hhhhhhHHHHHHHHHHhh-hCC
Q psy16466         32 YNCLKNECGKLENDLARL-RDP   52 (101)
Q Consensus        32 YN~LKeelA~vEedLkRL-RdP   52 (101)
                      ..+++.+..+++.++++| .||
T Consensus        33 i~~l~~e~~~L~~ei~~l~~~~   54 (80)
T PF04977_consen   33 IEELKKENEELKEEIERLKNDP   54 (80)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCH
Confidence            344555555555666666 444


No 16 
>PF06698 DUF1192:  Protein of unknown function (DUF1192);  InterPro: IPR009579 This family consists of several short, hypothetical, bacterial proteins of around 60 residues in length. The function of this family is unknown.
Probab=30.54  E-value=51  Score=21.38  Aligned_cols=27  Identities=26%  Similarity=0.332  Sum_probs=20.8

Q ss_pred             CChhhh--hhhhhHHHHHHHHHHhhhCCC
Q psy16466         27 FPLEQY--NCLKNECGKLENDLARLRDPL   53 (101)
Q Consensus        27 FDVe~Y--N~LKeelA~vEedLkRLRdPL   53 (101)
                      =|+..|  .+|.++++.++.++.|++.-+
T Consensus        16 ~dLs~lSv~EL~~RIa~L~aEI~R~~~~~   44 (59)
T PF06698_consen   16 EDLSLLSVEELEERIALLEAEIARLEAAI   44 (59)
T ss_pred             CCchhcCHHHHHHHHHHHHHHHHHHHHHH
Confidence            344444  489999999999999998543


No 17 
>PF04912 Dynamitin:  Dynamitin ;  InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []. It is also thought to modulate cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organisation during mitosis. Dynamitin is also involved in anchoring microtubules to centrosomes and may play a role in synapse formation during brain development []. ; GO: 0007017 microtubule-based process, 0005869 dynactin complex
Probab=29.17  E-value=51  Score=27.07  Aligned_cols=24  Identities=21%  Similarity=0.462  Sum_probs=20.9

Q ss_pred             ChhhhhhhhhHHHHHHHHHHhhhC
Q psy16466         28 PLEQYNCLKNECGKLENDLARLRD   51 (101)
Q Consensus        28 DVe~YN~LKeelA~vEedLkRLRd   51 (101)
                      ..++|++|+.|++++++++..+..
T Consensus        92 ~~~kl~RL~~Ev~EL~eEl~~~~~  115 (388)
T PF04912_consen   92 PEQKLQRLRREVEELKEELEKRKA  115 (388)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhh
Confidence            357999999999999999998753


No 18 
>PF13422 DUF4110:  Domain of unknown function (DUF4110)
Probab=28.71  E-value=32  Score=24.01  Aligned_cols=29  Identities=38%  Similarity=0.410  Sum_probs=22.6

Q ss_pred             hhhhccCCCh--hhhhhhhhHHHHHHHHHHh
Q psy16466         20 KRAKKVGFPL--EQYNCLKNECGKLENDLAR   48 (101)
Q Consensus        20 K~Akk~~FDV--e~YN~LKeelA~vEedLkR   48 (101)
                      |-.+|.+||+  ++|.++|..|.++|.-+..
T Consensus        44 KeLrk~aF~lAe~Ry~E~k~~l~~le~~~ee   74 (96)
T PF13422_consen   44 KELRKDAFDLAEERYWELKPELDELEDLEEE   74 (96)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5567888988  5799999999888765543


No 19 
>smart00040 CSF2 Granulocyte-macrophage colony-simulating factor (GM-CSF). GM-CSF stimulates the development of and the cytotoxic  activity of white blood cells.
Probab=27.75  E-value=26  Score=25.96  Aligned_cols=65  Identities=26%  Similarity=0.397  Sum_probs=48.2

Q ss_pred             cCCChhhhhhhhhHHHH----HHHHHHhhhCCCCCCCCCccccccCc--ccccccCchhHhhHHHHHHHHH
Q psy16466         25 VGFPLEQYNCLKNECGK----LENDLARLRDPLIPPYRGYEFQVPSD--LSYKQPSSSINKFKEQIKMILS   89 (101)
Q Consensus        25 ~~FDVe~YN~LKeelA~----vEedLkRLRdPL~l~~~~~~~~~p~~--~~~~~~~~~~~~~~~~~~~~~~   89 (101)
                      .-||.++=-.|.-+|..    +..+|-+|+.||.|.-.-|..|-|.+  .+-.-+.--+..|++-+|+.|-
T Consensus        45 e~Fd~qeptClQtRL~LYkqGLrGslt~Lkg~LtmmA~hYkq~CppTpEt~C~Tq~itfksFk~nLK~FLf  115 (121)
T smart00040       45 EMFDLQEPTCLQTRLKLYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCETQIITFKSFKENLKDFLF  115 (121)
T ss_pred             hccCCCCCcHHHHHHHHHHhhccccHHHhhcHHHHHHHHHHhcCCCCCCCcccceeeeHHHHHHHHHHHHh
Confidence            35888877777777765    45677899999999999999999994  4444444445666777777663


No 20 
>KOG4098|consensus
Probab=27.34  E-value=63  Score=24.55  Aligned_cols=24  Identities=21%  Similarity=0.452  Sum_probs=19.7

Q ss_pred             ChhhhhhhhhHHHHHHHHHHhhhC
Q psy16466         28 PLEQYNCLKNECGKLENDLARLRD   51 (101)
Q Consensus        28 DVe~YN~LKeelA~vEedLkRLRd   51 (101)
                      =+.+||.|+.++.++-..+-+|-.
T Consensus        20 v~a~yn~~r~el~~ia~ki~~LE~   43 (140)
T KOG4098|consen   20 VVAKYNALRSELQQIASKITDLEM   43 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            378999999999888887777763


No 21 
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=27.21  E-value=53  Score=25.77  Aligned_cols=30  Identities=17%  Similarity=0.388  Sum_probs=22.9

Q ss_pred             HHHHhhhhccCCChhhhhhhhhHHHHHHHH
Q psy16466         16 IHLHKRAKKVGFPLEQYNCLKNECGKLEND   45 (101)
Q Consensus        16 ~~FHK~Akk~~FDVe~YN~LKeelA~vEed   45 (101)
                      .+|+..|++.+.|++.+|++-|+=-++-.+
T Consensus        33 ~iFR~~A~e~gmsl~ef~~~AE~~p~iD~~   62 (179)
T COG1102          33 TIFREMARERGMSLEEFSRYAEEDPEIDKE   62 (179)
T ss_pred             HHHHHHHHHcCCCHHHHHHHHhcCchhhHH
Confidence            469999999999999999976653333333


No 22 
>PF09006 Surfac_D-trimer:  Lung surfactant protein D coiled-coil trimerisation;  InterPro: IPR015097 This domain is found in the SFTPD family, which includes lung surfactant protein D (SFTPD), conglutinin, collectin-43 and collectin-46. It forms a triple-helical parallel coiled coil, and mediates trimerisation of the protein []. ; PDB: 4DN8_A 3G84_A 2RIE_C 3IKR_B 1B08_A 2GGX_B 2OS9_C 2ORK_B 1PWB_A 2RIA_C ....
Probab=26.87  E-value=69  Score=20.16  Aligned_cols=22  Identities=23%  Similarity=0.474  Sum_probs=18.8

Q ss_pred             hhhhhHHHHHHHHHHhhhCCCC
Q psy16466         33 NCLKNECGKLENDLARLRDPLI   54 (101)
Q Consensus        33 N~LKeelA~vEedLkRLRdPL~   54 (101)
                      |.||.++..++..|++|...+.
T Consensus         2 ~aLrqQv~aL~~qv~~Lq~~fs   23 (46)
T PF09006_consen    2 NALRQQVEALQGQVQRLQAAFS   23 (46)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Confidence            6799999999999999986553


No 23 
>PRK11020 hypothetical protein; Provisional
Probab=26.09  E-value=70  Score=23.67  Aligned_cols=61  Identities=21%  Similarity=0.306  Sum_probs=39.6

Q ss_pred             hhccCCChhhhhhhhhHHHHHHHHHHhhhCCCCCC--CCCc-cccccC--cccccccCchhHhhHHH
Q psy16466         22 AKKVGFPLEQYNCLKNECGKLENDLARLRDPLIPP--YRGY-EFQVPS--DLSYKQPSSSINKFKEQ   83 (101)
Q Consensus        22 Akk~~FDVe~YN~LKeelA~vEedLkRLRdPL~l~--~~~~-~~~~p~--~~~~~~~~~~~~~~~~~   83 (101)
                      |-..+=|.+.|-++.+|++.++.++.||+.--.-.  -.|+ ...+|.  -++..|+... -++|+-
T Consensus        23 aa~~rgd~~~i~qf~~E~~~l~k~I~~lk~~~~~~lske~~~l~~lpF~R~iTK~EQADM-GkLKKS   88 (118)
T PRK11020         23 AASLRGDAEKYAQFEKEKATLEAEIARLKEVQSQKLSKEAQKLMKLPFSRAITKKEQADM-GKLKKS   88 (118)
T ss_pred             HHHhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcchhccHHHHHhH-HHHhhc
Confidence            44667799999999999999999999998543211  1222 234555  3666665544 444443


No 24 
>cd00040 CSF2 Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is a member of the large family of polypeptide growth factors called cytokines. It stimulates a wide variety of hematopoietic and nonhematopoietic cell types via binding to members of the cytokine receptor family, mainly the GM-CSF receptor.
Probab=26.09  E-value=28  Score=25.81  Aligned_cols=65  Identities=25%  Similarity=0.365  Sum_probs=47.6

Q ss_pred             cCCChhhhhhhhhHHHH----HHHHHHhhhCCCCCCCCCccccccCc--ccccccCchhHhhHHHHHHHHH
Q psy16466         25 VGFPLEQYNCLKNECGK----LENDLARLRDPLIPPYRGYEFQVPSD--LSYKQPSSSINKFKEQIKMILS   89 (101)
Q Consensus        25 ~~FDVe~YN~LKeelA~----vEedLkRLRdPL~l~~~~~~~~~p~~--~~~~~~~~~~~~~~~~~~~~~~   89 (101)
                      .-||.++=-.|.-+|..    +..+|-+|+.||.|.-.-|..|-|.+  .+-.-+.--+..|++-+|+.|-
T Consensus        45 e~Fd~qepTClQTRL~LYkqGLrGsltkLkg~LtmmAshYkqhCppTpEtsC~Tq~iTFksFkenLK~FLf  115 (121)
T cd00040          45 EMFDPQEPTCLQTRLKLYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCETQIITFKSFKENLKDFLF  115 (121)
T ss_pred             hccCCCCccHHHHHHHHHHhhccccHHHhccHHHHHHHHHHhcCCCCCCCcccceeeeHHHHHHHHHHHHh
Confidence            35777777777777755    55677899999999999999999994  4444444445667777777663


No 25 
>PF06569 DUF1128:  Protein of unknown function (DUF1128);  InterPro: IPR009507 This family consists of several short, hypothetical bacterial proteins of unknown function.
Probab=25.97  E-value=75  Score=21.46  Aligned_cols=27  Identities=30%  Similarity=0.474  Sum_probs=18.7

Q ss_pred             ccCCChhhhhhhhhH--------------HHHHHHHHHhhh
Q psy16466         24 KVGFPLEQYNCLKNE--------------CGKLENDLARLR   50 (101)
Q Consensus        24 k~~FDVe~YN~LKee--------------lA~vEedLkRLR   50 (101)
                      -..||.++|..|++=              +..+-++|.+||
T Consensus        30 ~~~f~~~~yedl~diy~~V~~K~~fS~sEm~aI~~ELG~LR   70 (71)
T PF06569_consen   30 PEDFSEEKYEDLKDIYEMVMSKDSFSPSEMQAIAEELGQLR   70 (71)
T ss_pred             HHhCChhhHHHHHHHHHHHHhccCCCHHHHHHHHHHHHhhc
Confidence            357999999999773              334556666666


No 26 
>PF11461 RILP:  Rab interacting lysosomal protein;  InterPro: IPR021563  RILP contains a domain which contains two coiled-coil regions and is found mainly in the cytosol. RILP is recruited onto late endosomal and lysosomal membranes by Rab7 and acts as a downstream effector of Rab7. This recruitment process is important for phagosome maturation and fusion with late endosomes and lysosomes. ; PDB: 1YHN_B.
Probab=25.76  E-value=71  Score=20.88  Aligned_cols=25  Identities=32%  Similarity=0.371  Sum_probs=20.8

Q ss_pred             hhhhhhhhHHHHHHHHHHhhhCCCC
Q psy16466         30 EQYNCLKNECGKLENDLARLRDPLI   54 (101)
Q Consensus        30 e~YN~LKeelA~vEedLkRLRdPL~   54 (101)
                      ..=|+||-++-.++++|.-.|..+.
T Consensus        10 ~ERNeLK~~v~~leEEL~~yk~~~~   34 (60)
T PF11461_consen   10 QERNELKARVFLLEEELAYYKSELL   34 (60)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcccC
Confidence            3459999999999999998886554


No 27 
>PF12022 DUF3510:  Domain of unknown function (DUF3510);  InterPro: IPR024603  The COG complex comprises eight proteins (COG1-8) and plays critical roles in Golgi structure and function []. This uncharacterised domain is found in the C-terminal of COG complex subunit 2 proteins.
Probab=25.74  E-value=74  Score=22.46  Aligned_cols=22  Identities=23%  Similarity=0.225  Sum_probs=16.6

Q ss_pred             hhhhhhhHHHHHHHHHHhhhCC
Q psy16466         31 QYNCLKNECGKLENDLARLRDP   52 (101)
Q Consensus        31 ~YN~LKeelA~vEedLkRLRdP   52 (101)
                      .++++-.-+.+.|++|+||+.-
T Consensus        78 ~~~evL~sv~KtEeSL~rlkk~   99 (125)
T PF12022_consen   78 IASEVLTSVRKTEESLKRLKKR   99 (125)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            3555566677889999999864


No 28 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=25.24  E-value=94  Score=22.42  Aligned_cols=19  Identities=42%  Similarity=0.742  Sum_probs=15.6

Q ss_pred             cCcchhhHHHHHHHHHhhhhccCC
Q psy16466          4 YYLPDVRDRQFLIHLHKRAKKVGF   27 (101)
Q Consensus         4 Y~Yp~ardRq~L~~FHK~Akk~~F   27 (101)
                      -.||.||+|     +-+-..+-++
T Consensus        61 iSYPTvR~r-----Ld~ii~~lg~   79 (113)
T PF09862_consen   61 ISYPTVRNR-----LDKIIEKLGY   79 (113)
T ss_pred             CCcHHHHHH-----HHHHHHHhCC
Confidence            369999999     8888888777


No 29 
>PF08663 HalX:  HalX domain;  InterPro: IPR013971  HalX is a protein of unknown function, previously mis-annotated as HoxA-like transcriptional regulator. It is C-terminal to a CheY-like superfamily domain and suggests a role as a response regulator. 
Probab=24.01  E-value=81  Score=20.82  Aligned_cols=26  Identities=23%  Similarity=0.363  Sum_probs=22.2

Q ss_pred             ChhhhhhhhhHHHHHHHHHHhhhCCC
Q psy16466         28 PLEQYNCLKNECGKLENDLARLRDPL   53 (101)
Q Consensus        28 DVe~YN~LKeelA~vEedLkRLRdPL   53 (101)
                      +=+.|-+|+++++.++.+|..+.+.+
T Consensus        34 ~seeY~eL~~ri~~lr~~ld~~~~~~   59 (71)
T PF08663_consen   34 ESEEYQELEDRIEELRAELDDTLDEF   59 (71)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            45789999999999999998887665


No 30 
>PF08802 CytB6-F_Fe-S:  Cytochrome B6-F complex Fe-S subunit ;  InterPro: IPR014909 The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. The cytochrome b6-f complex has 4 large subunits, these are: cytochrome b6, subunit IV (17 kDa polypeptide, PetD), cytochrome f and the Rieske protein, while the 4 small subunits are: PetG, PetL, PetM and PetN. The complex functions as a dimer.  This protein corresponds to the alpha helical transmembrane domain of the cytochrome b6-f complex Rieske iron-sulphur subunit. ; GO: 0009496 plastoquinol-plastocyanin reductase activity, 0051537 2 iron, 2 sulfur cluster binding, 0055114 oxidation-reduction process, 0042651 thylakoid membrane; PDB: 1Q90_R 1VF5_D 2E75_D 2E74_D 2E76_D 2D2C_Q 2ZT9_D.
Probab=23.68  E-value=58  Score=19.69  Aligned_cols=14  Identities=36%  Similarity=0.591  Sum_probs=9.4

Q ss_pred             cchhhHHHHHHHHH
Q psy16466          6 LPDVRDRQFLIHLH   19 (101)
Q Consensus         6 Yp~ardRq~L~~FH   19 (101)
                      -||+..||+|+++=
T Consensus         3 VPdm~RR~lmN~ll   16 (39)
T PF08802_consen    3 VPDMSRRQLMNLLL   16 (39)
T ss_dssp             ---HHHHHHHHHHH
T ss_pred             CCChhHHHHHHHHH
Confidence            48899999998863


No 31 
>PF07443 HARP:  HepA-related protein (HARP);  InterPro: IPR010003 This entry represents a conserved region approximately 60 residues long within eukaryotic HepA-related protein (HARP). This exhibits single-stranded DNA-dependent ATPase activity, and is ubiquitously expressed in human and mouse tissues []. Family members may contain more than one copy of this region.; GO: 0004386 helicase activity, 0005524 ATP binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0016568 chromatin modification, 0005634 nucleus
Probab=23.12  E-value=37  Score=21.78  Aligned_cols=21  Identities=29%  Similarity=0.564  Sum_probs=15.9

Q ss_pred             hhhccCCChhhhhhhhhHHHH
Q psy16466         21 RAKKVGFPLEQYNCLKNECGK   41 (101)
Q Consensus        21 ~Akk~~FDVe~YN~LKeelA~   41 (101)
                      +.++=.|+++.||.|.+.+..
T Consensus        26 ~Tr~W~F~L~Dy~~L~~~~~~   46 (55)
T PF07443_consen   26 KTRKWNFSLEDYSTLMKKVRN   46 (55)
T ss_pred             cceeeeeeHHHHHHHHHHHhc
Confidence            345668999999999876643


No 32 
>PF04210 MtrG:  Tetrahydromethanopterin S-methyltransferase, subunit G ;  InterPro: IPR005866  This model describes the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit G in methanogenic archaea. This methyltranferase is a membrane-associated enzyme complex that uses methyl-transfer reaction to drive a sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of a methyl group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase.; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0015948 methanogenesis, 0016021 integral to membrane
Probab=22.80  E-value=90  Score=21.19  Aligned_cols=23  Identities=9%  Similarity=0.160  Sum_probs=19.6

Q ss_pred             CCChhhhhhhhhHHHHHHHHHHh
Q psy16466         26 GFPLEQYNCLKNECGKLENDLAR   48 (101)
Q Consensus        26 ~FDVe~YN~LKeelA~vEedLkR   48 (101)
                      =-|-.+||++.++|.++|+.+.-
T Consensus         8 iv~~~~~~~i~~rLd~iEeKvEf   30 (70)
T PF04210_consen    8 IVDPDDFNEIMKRLDEIEEKVEF   30 (70)
T ss_pred             eeCHHHHHHHHHHHHHHHHHHHh
Confidence            34778999999999999998764


No 33 
>TIGR01837 PHA_granule_1 poly(hydroxyalkanoate) granule-associated protein. This model describes a domain found in some proteins associated with polyhydroxyalkanoate (PHA) granules in a subset of species that have PHA inclusion granules. Included are two tandem proteins of Pseudomonas oleovorans, PhaI and PhaF, and their homologs in related species. PhaF proteins have a low-complexity C-terminal region with repeats similar to AAAKP.
Probab=22.69  E-value=91  Score=21.93  Aligned_cols=22  Identities=23%  Similarity=0.363  Sum_probs=19.4

Q ss_pred             hhhhhhhhHHHHHHHHHHhhhC
Q psy16466         30 EQYNCLKNECGKLENDLARLRD   51 (101)
Q Consensus        30 e~YN~LKeelA~vEedLkRLRd   51 (101)
                      +..+.|..++++++..|.+|..
T Consensus        96 ~ev~~L~~RI~~Le~~l~~l~~  117 (118)
T TIGR01837        96 EEIEALSAKIEQLAVQVEELRR  117 (118)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhc
Confidence            6788999999999999999864


No 34 
>PF07334 IFP_35_N:  Interferon-induced 35 kDa protein (IFP 35) N-terminus;  InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration []. This group of proteins also includes N-myc-interactor (Nmi), a homologous interferon-induced protein.
Probab=22.38  E-value=67  Score=21.91  Aligned_cols=23  Identities=30%  Similarity=0.316  Sum_probs=18.9

Q ss_pred             hhhhHHHHHHHHHHhhhCCCCCC
Q psy16466         34 CLKNECGKLENDLARLRDPLIPP   56 (101)
Q Consensus        34 ~LKeelA~vEedLkRLRdPL~l~   56 (101)
                      +||+++.++|.+|..++.-.++.
T Consensus        11 ~Lk~eiqkle~ELq~~~~~~qIk   33 (76)
T PF07334_consen   11 RLKEEIQKLEAELQQNKREFQIK   33 (76)
T ss_pred             HHHHHHHHHHHHHHHHHhhhhhc
Confidence            69999999999999988775543


No 35 
>TIGR03782 Bac_Flav_CT_J Bacteroides conjugative transposon TraJ protein. Members of this protein family are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage. This family is related conjugation system proteins in the Proteobacteria, including TrbL of Agrobacterium Ti plasmids and VirB6.
Probab=22.04  E-value=62  Score=27.43  Aligned_cols=34  Identities=21%  Similarity=0.242  Sum_probs=27.3

Q ss_pred             HHHhhhhccCCChhhhhhhhhHHHHHHHHHHhhhCCCC
Q psy16466         17 HLHKRAKKVGFPLEQYNCLKNECGKLENDLARLRDPLI   54 (101)
Q Consensus        17 ~FHK~Akk~~FDVe~YN~LKeelA~vEedLkRLRdPL~   54 (101)
                      -.|...+.+.||+++|.+-||++    +....+|+|-.
T Consensus        89 gT~~m~~~q~~dl~~l~~qkd~L----~~e~~~r~~~t  122 (322)
T TIGR03782        89 GTHSMLEGQTLDMNRYREQKDKL----EYEAMVRDPET  122 (322)
T ss_pred             hHHHHHHccHHHHHHHHHHHHHH----HHHHHhcCcch
Confidence            46888999999999999999887    34456788854


No 36 
>PF01920 Prefoldin_2:  Prefoldin subunit;  InterPro: IPR002777  Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea. Eukaryotic PFD is a multi-subunit complex containing six polypeptides in the molecular mass range of 14-23 kDa. In archaea, on the other hand, PFD is composed of two types of subunits, two alpha and four beta. The six subunits associate to form two back-to-back up-and-down eight-stranded barrels, from which hang six coiled coils. Each subunit contributes one (beta subunits) or two (alpha subunits) beta hairpin turns to the barrels. The coiled coils are formed by the N and C termini of an individual subunit. Overall, this unique arrangement resembles a jellyfish. The eukaryotic PFD hexamer is composed of six different subunits; however, these can be grouped into two alpha-like (PFD3 and -5) and four beta-like (PFD1, -2, -4, and -6) subunits based on amino acid sequence similarity with their archaeal counterparts. Eukaryotic PFD has a six-legged structure similar to that seen in the archaeal homologue [, ]. This family contains the archaeal beta subunit, eukaryotic prefoldin subunits 1, 2, 4 and 6.  Eukaryotic PFD has been shown to bind both actin and tubulin co-translationally. The chaperone then delivers the target protein to CCT, interacting with the chaperonin through the tips of the coiled coils. No authentic target proteins of any archaeal PFD have been identified, to date.; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0016272 prefoldin complex; PDB: 2ZDI_B 3AEI_B 2ZQM_A 1FXK_A.
Probab=20.94  E-value=1.2e+02  Score=19.52  Aligned_cols=21  Identities=19%  Similarity=0.463  Sum_probs=12.1

Q ss_pred             hhhhhhhhHHHHHHHHHHhhh
Q psy16466         30 EQYNCLKNECGKLENDLARLR   50 (101)
Q Consensus        30 e~YN~LKeelA~vEedLkRLR   50 (101)
                      .+|+.|..++..+...+..|.
T Consensus         5 ~~~~~l~~~l~~~~~q~~~l~   25 (106)
T PF01920_consen    5 NKFQELNQQLQQLEQQIQQLE   25 (106)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            456666666666555555554


No 37 
>PF12652 CotJB:  CotJB protein;  InterPro: IPR024207 The cotJ operon proteins affect spore coat composition, and is controlled by sigma E. The genes, which include CotJB, are either required for the normal formation of the inner layers of the coat or are themselves structural components of the coat []. CotJB has been identified as a spore coat protein [].
Probab=20.75  E-value=1.3e+02  Score=20.19  Aligned_cols=26  Identities=27%  Similarity=0.434  Sum_probs=24.0

Q ss_pred             hhhhhhhhhHHHHHHHHHHhhhCCCC
Q psy16466         29 LEQYNCLKNECGKLENDLARLRDPLI   54 (101)
Q Consensus        29 Ve~YN~LKeelA~vEedLkRLRdPL~   54 (101)
                      ++.||+...+..++.++-.+.-.||.
T Consensus        32 l~~y~~~~~~~~~l~~~Ye~~yGPLt   57 (78)
T PF12652_consen   32 LEYYNEYSKQRKQLKKEYEKRYGPLT   57 (78)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCCc
Confidence            67899999999999999999999987


Done!