BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy16470
(197 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CA8|A Chain A, Crystal Structure Of Escherichia Coli Ydcf, An
S-Adenosyl-L-Methionine Utilizing Enzyme
pdb|3CA8|B Chain B, Crystal Structure Of Escherichia Coli Ydcf, An
S-Adenosyl-L-Methionine Utilizing Enzyme
Length = 266
Score = 27.3 bits (59), Expect = 6.0, Method: Compositional matrix adjust.
Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 7/71 (9%)
Query: 18 FGSGIGGNLASAIFVPYRADVGPAGAHFGLLACLIVEV-------GPAGAHFGLLACLIV 70
F +G N S IF+ + P + LL + + GP G F +
Sbjct: 182 FVPQLGNNADSVIFINQLQGLWPVERYLSLLTGELPRLRDDSDGYGPRGRDFIVHVDFPA 241
Query: 71 EVLNCWPLLKH 81
EV++ W LKH
Sbjct: 242 EVIHAWQTLKH 252
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.147 0.497
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,813,970
Number of Sequences: 62578
Number of extensions: 149561
Number of successful extensions: 253
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 253
Number of HSP's gapped (non-prelim): 1
length of query: 197
length of database: 14,973,337
effective HSP length: 94
effective length of query: 103
effective length of database: 9,091,005
effective search space: 936373515
effective search space used: 936373515
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)