Diaphorina citri psyllid: psy16514


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MSTTIFDRGKPRRGMMRRAVFSDLQRKGLEKRFQIQKYISKPDRKKLAEKLGLKDSQVKIWFQNRRMKWRNSKERELLANGGSREQTLPNKNNPNPDLSDADCDRPKIDLSNVNIDYDEEEEDDLMRPKTKFTDNEAESSEVEDDGDDDEEINVT
ccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*******************VFSDLQRKGLEKRFQIQKYISKPDRKKLAEKLGLKDSQVKIWFQNRRM****************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTTIFDRGKPRRGMMRRAVFSDLQRKGLEKRFQIQKYISKPDRKKLAEKLGLKDSQVKIWFQNRRMKWRNSKERELLANGGSREQTLPNKNNPNPDLSDADCDRPKIDLSNVNIDYDEEEEDDLMRPKTKFTDNEAESSEVEDDGDDDEEINVT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein DBX1-A confidentQ9PTU1
Homeobox protein DBX1 Could have a role in patterning the central nervous system during embryogenesis. Has a key role in regulating the distinct phenotypic features that distinguish two major classes of ventral interneurons, V0 and V1 neurons. Regulates the transcription factor profile, neurotransmitter phenotype, intraspinal migratory path and axonal trajectory of V0 neurons, features that differentiate them from an adjacent set of V1 neurons.confidentP52950
Homeobox protein DBX1 Could have a role in patterning the central nervous system during embryogenesis. Has a key role in regulating the distinct phenotypic features that distinguish two major classes of ventral interneurons, V0 and V1 neurons. Regulates the transcription factor profile, neurotransmitter phenotype, intraspinal migratory path and axonal trajectory of V0 neurons, features that differentiate them from an adjacent set of V1 neurons.confidentA6NMT0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0046622 [BP]positive regulation of organ growthprobableGO:0045927, GO:0046620, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008
GO:0048557 [BP]embryonic digestive tract morphogenesisprobableGO:0048598, GO:0032502, GO:0009887, GO:0048562, GO:0048565, GO:0044707, GO:0048566, GO:0048568, GO:0032501, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0048546, GO:0055123
GO:0000976 [MF]transcription regulatory region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0001889 [BP]liver developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0021521 [BP]ventral spinal cord interneuron specificationprobableGO:0060573, GO:0021515, GO:0021514, GO:0021517, GO:0030154, GO:0021511, GO:0060579, GO:0021513, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048869, GO:0001708, GO:0008150, GO:0021953, GO:0032502, GO:0048665, GO:0048663, GO:0030182, GO:0009987, GO:0021510, GO:0060581, GO:0003002, GO:0048731, GO:0022008, GO:0048699, GO:0045165, GO:0009953, GO:0007399, GO:0044707, GO:0048856, GO:0044763
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0007519 [BP]skeletal muscle tissue developmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0044767, GO:0061061, GO:0014706, GO:0048513, GO:0008150, GO:0060537, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0048484 [BP]enteric nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048483, GO:0048731, GO:0007275, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0090304 [BP]nucleic acid metabolic processprobableGO:0006139, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PUF, chain A
Confidence level:very confident
Coverage over the Query: 5-75
View the alignment between query and template
View the model in PyMOL