Query         psy16515
Match_columns 570
No_of_seqs    225 out of 731
Neff          5.9 
Searched_HMMs 29240
Date          Fri Aug 16 23:18:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16515.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/16515hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2l2t_A Receptor tyrosine-prote  36.1      25 0.00087   25.7   2.8   18  512-529    24-41  (44)
  2 2ks1_B Epidermal growth factor  29.2      26 0.00088   25.6   1.9   16  513-528    26-41  (44)
  3 2jo1_A Phospholemman; FXYD1, N  25.9      84  0.0029   25.2   4.4   30  499-529    20-49  (72)
  4 2jwa_A Receptor tyrosine-prote  23.3      37  0.0013   24.8   1.8    9  519-527    32-40  (44)
  5 2k1k_A Ephrin type-A receptor   19.0      79  0.0027   22.2   2.7   18  507-524    20-37  (38)
  6 2l8s_A Integrin alpha-1; trans  17.3      78  0.0027   24.1   2.5   16  507-522    16-31  (54)
  7 2knc_A Integrin alpha-IIB; tra   9.6 2.1E+02   0.007   21.7   2.8   16  507-522    19-34  (54)
  8 2kxr_A Tight junction protein    8.4      91  0.0031   27.3   0.5   27  351-385    69-95  (118)
  9 1iij_A ERBB-2 receptor protein   8.0 2.3E+02   0.008   19.6   2.3    6  520-525    29-34  (35)
 10 2knc_B Integrin beta-3; transm   8.0 1.7E+02  0.0058   23.7   1.9   23  501-523    11-33  (79)

No 1  
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens}
Probab=36.13  E-value=25  Score=25.68  Aligned_cols=18  Identities=11%  Similarity=0.161  Sum_probs=9.0

Q ss_pred             HHHHHHhheeeeeCCCCc
Q psy16515        512 LLLITAVFCLIRNSSRQS  529 (570)
Q Consensus       512 ill~~~~~~~~~~~~~~~  529 (570)
                      +++++++++++|++++++
T Consensus        24 ~ii~~~~~~~~RRRr~~~   41 (44)
T 2l2t_A           24 VIVGLTFAVYVRRKSIKK   41 (44)
T ss_dssp             HHHHHHHHHHHHTTCSSC
T ss_pred             HHHHHHHHHHhhhhhhhh
Confidence            333444456666655443


No 2  
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens}
Probab=29.22  E-value=26  Score=25.61  Aligned_cols=16  Identities=6%  Similarity=0.077  Sum_probs=7.8

Q ss_pred             HHHHHhheeeeeCCCC
Q psy16515        513 LLITAVFCLIRNSSRQ  528 (570)
Q Consensus       513 ll~~~~~~~~~~~~~~  528 (570)
                      ++++++++++|+++++
T Consensus        26 ii~~~~~~~~RRr~~~   41 (44)
T 2ks1_B           26 VVALGIGLFMRRRHIV   41 (44)
T ss_dssp             HHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHHhhhhHhh
Confidence            3334444566555443


No 3  
>2jo1_A Phospholemman; FXYD1, Na,K-ATPase, micelle, hydrolase regulator; NMR {Homo sapiens}
Probab=25.94  E-value=84  Score=25.17  Aligned_cols=30  Identities=27%  Similarity=0.491  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHhheeeeeCCCCc
Q psy16515        499 KVVLLYILFTAGTLLLITAVFCLIRNSSRQS  529 (570)
Q Consensus       499 ~~~~~~~~~~~G~ill~~~~~~~~~~~~~~~  529 (570)
                      +.+...+++++|+++++..= |-|+..++++
T Consensus        20 GLifA~vLfi~GI~iilS~K-ckCk~~qk~r   49 (72)
T 2jo1_A           20 GLVIAGILFILGILIVLSRR-CRCKFNQQQR   49 (72)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH-HHHHHCTTTS
T ss_pred             chHHHHHHHHHHHHHHHcCc-cccCCCCCCC
Confidence            34445566777777665544 4444443333


No 4  
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A
Probab=23.27  E-value=37  Score=24.82  Aligned_cols=9  Identities=22%  Similarity=0.231  Sum_probs=4.0

Q ss_pred             heeeeeCCC
Q psy16515        519 FCLIRNSSR  527 (570)
Q Consensus       519 ~~~~~~~~~  527 (570)
                      ++++|+++.
T Consensus        32 ~~~~RRR~~   40 (44)
T 2jwa_A           32 GILIKRRQQ   40 (44)
T ss_dssp             HHHHHHHCS
T ss_pred             Hhheehhhh
Confidence            344544433


No 5  
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A
Probab=19.00  E-value=79  Score=22.21  Aligned_cols=18  Identities=22%  Similarity=0.307  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHhheeeee
Q psy16515        507 FTAGTLLLITAVFCLIRN  524 (570)
Q Consensus       507 ~~~G~ill~~~~~~~~~~  524 (570)
                      .++|+.+++..+++++|+
T Consensus        20 ~v~gv~li~~l~~~~~rr   37 (38)
T 2k1k_A           20 LLLGAALLLGILVFRSRR   37 (38)
T ss_dssp             HHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHeec
Confidence            444555554444444443


No 6  
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens}
Probab=17.27  E-value=78  Score=24.10  Aligned_cols=16  Identities=38%  Similarity=0.480  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHhheee
Q psy16515        507 FTAGTLLLITAVFCLI  522 (570)
Q Consensus       507 ~~~G~ill~~~~~~~~  522 (570)
                      +..|++++++.++++|
T Consensus        16 vl~GLLLL~Lii~~Lw   31 (54)
T 2l8s_A           16 AFAGLLLLMLLILALW   31 (54)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3445555444444333


No 7  
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens}
Probab=9.59  E-value=2.1e+02  Score=21.73  Aligned_cols=16  Identities=31%  Similarity=0.441  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHhheee
Q psy16515        507 FTAGTLLLITAVFCLI  522 (570)
Q Consensus       507 ~~~G~ill~~~~~~~~  522 (570)
                      +..|++++++.++++|
T Consensus        19 vl~GLllL~li~~~Lw   34 (54)
T 2knc_A           19 VLGGLLLLTILVLAMW   34 (54)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3445555544444444


No 8  
>2kxr_A Tight junction protein ZO-1; beta-barrel, protein binding; NMR {Homo sapiens}
Probab=8.43  E-value=91  Score=27.30  Aligned_cols=27  Identities=30%  Similarity=0.589  Sum_probs=19.9

Q ss_pred             CCCCCcceeccCCCCCCceeecccccccCCccccc
Q psy16515        351 PCAPKGLFNVSLCQYDSPVMLSFPHFYLGNQSLLD  385 (570)
Q Consensus       351 ~C~p~Gl~nlS~C~~gaPi~~S~PHFy~aDp~l~~  385 (570)
                      .|.|.|+.      +.-|+++++||+  |.+.+.+
T Consensus        69 ~cGP~G~~------F~~PViL~iPHc--a~~~W~~   95 (118)
T 2kxr_A           69 AAGPHGLK------FLKPVELRLPHC--DPKTWQN   95 (118)
T ss_dssp             ECSSSCCE------EEEEEEEEECCC--CTTSSCS
T ss_pred             EECCCCCc------CcCCEEEEcCCC--Cccchhh
Confidence            48888874      456999999999  4555544


No 9  
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1
Probab=8.02  E-value=2.3e+02  Score=19.59  Aligned_cols=6  Identities=33%  Similarity=0.540  Sum_probs=2.8

Q ss_pred             eeeeeC
Q psy16515        520 CLIRNS  525 (570)
Q Consensus       520 ~~~~~~  525 (570)
                      +++|++
T Consensus        29 ~~iRRr   34 (35)
T 1iij_A           29 ILIKRR   34 (35)
T ss_dssp             HHHHHC
T ss_pred             eEEeec
Confidence            455443


No 10 
>2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens}
Probab=7.99  E-value=1.7e+02  Score=23.71  Aligned_cols=23  Identities=13%  Similarity=0.258  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHhheeee
Q psy16515        501 VLLYILFTAGTLLLITAVFCLIR  523 (570)
Q Consensus       501 ~~~~~~~~~G~ill~~~~~~~~~  523 (570)
                      ...++.++.|++|+.+.++++||
T Consensus        11 ~~Iv~gvi~gilliGllllliwk   33 (79)
T 2knc_B           11 LVVLLSVMGAILLIGLAALLIWK   33 (79)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHH


Done!