Diaphorina citri psyllid: psy16516


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MWTVLVDSRRLCVDTALGRKARRRDKETSLCSDDPKLYLEETVLERKLPDIDLRLLVEMPQGVDFNEWLASHSMKSHGIPGFLLFTLGFSYVALNTNVFSSVSAIAIFDNINLIYGTISEFCTMSECPDMSGPSFRTYLWVDEKGKKSRIAAPQYVDYVMTYIQKTIGDESNFPTKYGK
cCEEcccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHcccccccHHHHHHHHHcccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccccCECcccHHHHHHHHHHHHHHccccccccccccc
MWTVLVDSRRLCVDTAL*****************PKLYLEETVLERKLPDIDLRLLVEMPQGVDFNEWLASHSMKSHGIPGFLLFTLGFSYVALNTNVFSSVSAIAIFDNINLIYGTISEFCTMSECPDMSGPSFRTYLWVDEKGKKSRIAAPQYVDYVMTYIQKTIGDESNFPT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWTVLVDSRRLCVDTALGRKARRRDKETSLCSDDPKLYLEETVLERKLPDIDLRLLVEMPQGVDFNEWLASHSMKSHGIPGFLLFTLGFSYVALNTNVFSSVSAIAIFDNINLIYGTISEFCTMSECPDMSGPSFRTYLWVDEKGKKSRIAAPQYVDYVMTYIQKTIGDESNFPTKYGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MOB kinase activator-like 1 homolog A confidentQ54XJ0
MOB kinase activator-like 2 Required for the normal morphogenesis of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites.confidentQ2LZ59

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005935 [CC]cellular bud neckprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0019207 [MF]kinase regulator activityprobableGO:0030234, GO:0003674
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PI1, chain A
Confidence level:very confident
Coverage over the Query: 45-73,105-179
View the alignment between query and template
View the model in PyMOL