Query         psy16518
Match_columns 283
No_of_seqs    303 out of 1313
Neff          5.0 
Searched_HMMs 29240
Date          Fri Aug 16 23:22:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16518.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/16518hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2ks1_B Epidermal growth factor   8.9 1.6E+02  0.0056   19.6   1.8   16   32-47     16-31  (44)
  2 1qle_D Cytochrome AA3, ccytoch   8.4 1.8E+02  0.0061   19.3   1.8   15   27-41     14-28  (43)
  3 1fqj_C Retinal ROD rhodopsin-s   7.8 1.5E+02  0.0051   19.6   1.2   19  102-121     1-19  (42)
  4 2l2t_A Receptor tyrosine-prote   7.6   2E+02  0.0069   19.2   1.8   11   31-41     10-20  (44)
  5 1m56_D Cytochrome C oxidase; m   7.0 2.2E+02  0.0075   19.5   1.8   16   27-42     22-37  (51)
  6 1kvd_A SMK toxin; halotolerant   5.3 2.6E+02   0.009   19.5   1.4   25   23-47     18-42  (63)
  7 2wwb_A Protein transport prote   5.2 2.9E+02    0.01   26.8   2.2   32  127-161    20-51  (476)
  8 2ju4_A GMP-PDE gamma, retinal    5.0 2.5E+02  0.0084   21.2   1.2   22  100-122    44-65  (87)
  9 3odh_A Okrai endonuclease; alp   4.8 2.8E+02  0.0097   24.0   1.6   19  101-119   175-193 (194)
 10 1qd6_C Protein (outer membrane   4.7 1.4E+02  0.0047   26.7  -0.5    8  269-276   216-223 (240)

No 1  
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens}
Probab=8.94  E-value=1.6e+02  Score=19.57  Aligned_cols=16  Identities=25%  Similarity=0.333  Sum_probs=8.0

Q ss_pred             HHHhHHHHHHHHHHhh
Q psy16518         32 GFIGGGFATFSYALCQ   47 (283)
Q Consensus        32 G~igG~i~s~i~~~~~   47 (283)
                      |.+||++..++++++.
T Consensus        16 gVVgGv~~~~ii~~~~   31 (44)
T 2ks1_B           16 GMVGALLLLLVVALGI   31 (44)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             ehhHHHHHHHHHHHHH
Confidence            5555555544444433


No 2  
>1qle_D Cytochrome AA3, ccytochrome C oxidase; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans} SCOP: f.23.8.1
Probab=8.36  E-value=1.8e+02  Score=19.27  Aligned_cols=15  Identities=33%  Similarity=0.494  Sum_probs=10.8

Q ss_pred             CCchhHHHhHHHHHH
Q psy16518         27 KKTWEGFIGGGFATF   41 (283)
Q Consensus        27 ~KT~EG~igG~i~s~   41 (283)
                      .||++||+.-.--+.
T Consensus        14 E~Ty~gFi~~~k~gt   28 (43)
T 1qle_D           14 QATFAGFIKGATWVS   28 (43)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            489999998754443


No 3  
>1fqj_C Retinal ROD rhodopsin-sensitive CGMP 3',5'- cyclic phosphodiesterase gamma-subunit...; RGS9, transducin, effector, pdegamma, G protein; HET: GDP; 2.02A {Bos taurus} SCOP: j.51.1.1
Probab=7.85  E-value=1.5e+02  Score=19.55  Aligned_cols=19  Identities=11%  Similarity=0.177  Sum_probs=11.2

Q ss_pred             cccccccccCCCCCCcccch
Q psy16518        102 AQIDLSSKINQGTNKVPSLL  121 (283)
Q Consensus       102 gVKD~g~~iP~G~gg~ld~l  121 (283)
                      |+|-+++.+| |+.|..--+
T Consensus         1 gv~gf~~~ip-GmeglgtD~   19 (42)
T 1fqj_C            1 GVQGFGDDIP-GMEGLGTDI   19 (42)
T ss_dssp             ----CTTCCS-CCTTCCHHH
T ss_pred             CCcccccccc-cccccCCCe
Confidence            6888999999 888765433


No 4  
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens}
Probab=7.61  E-value=2e+02  Score=19.18  Aligned_cols=11  Identities=9%  Similarity=0.048  Sum_probs=4.8

Q ss_pred             hHHHhHHHHHH
Q psy16518         31 EGFIGGGFATF   41 (283)
Q Consensus        31 EG~igG~i~s~   41 (283)
                      .+..+|+++++
T Consensus        10 ~aIA~gVVgGv   20 (44)
T 2l2t_A           10 PLIAAGVIGGL   20 (44)
T ss_dssp             HHHHHHHHHHH
T ss_pred             ceEEEeehHHH
Confidence            33444444433


No 5  
>1m56_D Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} SCOP: f.23.8.1 PDB: 1m57_D*
Probab=7.04  E-value=2.2e+02  Score=19.52  Aligned_cols=16  Identities=25%  Similarity=0.229  Sum_probs=11.3

Q ss_pred             CCchhHHHhHHHHHHH
Q psy16518         27 KKTWEGFIGGGFATFS   42 (283)
Q Consensus        27 ~KT~EG~igG~i~s~i   42 (283)
                      .||++||+.-.--+.+
T Consensus        22 e~Ty~gFi~~~k~gt~   37 (51)
T 1m56_D           22 EKTFAGFVRMVTWAAV   37 (51)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3899999987644433


No 6  
>1kvd_A SMK toxin; halotolerant yeast; 1.80A {Pichia farinosa} SCOP: d.70.1.2 PDB: 1kve_A
Probab=5.27  E-value=2.6e+02  Score=19.48  Aligned_cols=25  Identities=20%  Similarity=0.276  Sum_probs=20.0

Q ss_pred             ccCCCCchhHHHhHHHHHHHHHHhh
Q psy16518         23 KLSPKKTWEGFIGGGFATFSYALCQ   47 (283)
Q Consensus        23 ~iSP~KT~EG~igG~i~s~i~~~~~   47 (283)
                      --|-.-|.-|..||+++.+..+++.
T Consensus        18 gcsgaatfgglaggivgciaagila   42 (63)
T 1kvd_A           18 GCSGAATFGGLAGGIVGCIAAGILA   42 (63)
T ss_dssp             CCSSCCCCTTCCSHHHHHHHHHHHH
T ss_pred             CCccchhcccccchHHHHHHHHHHH
Confidence            4677889999999999888776543


No 7  
>2wwb_A Protein transport protein SEC61 subunit alpha ISO; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris}
Probab=5.18  E-value=2.9e+02  Score=26.80  Aligned_cols=32  Identities=19%  Similarity=0.181  Sum_probs=24.5

Q ss_pred             ccccchhhHHHHHHHHHHHHHHHHHHHhcCcceEe
Q psy16518        127 GFSERWKNWIIRGIFTWIMIGFFVLIVYGGPLALM  161 (283)
Q Consensus       127 glp~r~~nf~vRti~T~vmi~~F~~ii~~Gh~~~~  161 (283)
                      +.|+|...+.-|-.||..++.-|.   .+.|+++-
T Consensus        20 ~~P~~~~~lr~kil~Tl~~L~iyr---igs~IPlp   51 (476)
T 2wwb_A           20 QKPERKIQFKEKVLWTAITLFIFL---VCCQIPLF   51 (476)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHHHH---HHHHSCCC
T ss_pred             CCCCcCccHHHHHHHHHHHHHHHH---HHccCCCC
Confidence            366788899999999999999888   44444443


No 8  
>2ju4_A GMP-PDE gamma, retinal ROD rhodopsin-sensitive CGMP 3',5'-cyclic phosphodiesterase subunit gamma...; intrinsic disordered protein; HET: RCY; NMR {Bos taurus}
Probab=4.98  E-value=2.5e+02  Score=21.21  Aligned_cols=22  Identities=14%  Similarity=0.137  Sum_probs=17.3

Q ss_pred             cccccccccccCCCCCCcccchh
Q psy16518        100 DKAQIDLSSKINQGTNKVPSLLN  122 (283)
Q Consensus       100 r~gVKD~g~~iP~G~gg~ld~ld  122 (283)
                      ..|||-+++.|| |..|+-.-+.
T Consensus        44 KkGvkGfgddip-gmeglgtdit   65 (87)
T 2ju4_A           44 KKGVQGCGDDIP-GMEGCGTDIT   65 (87)
T ss_dssp             CSSSSCCCCSSC-SSSSCSHHHH
T ss_pred             CCCccccccccc-ccccccCCee
Confidence            379999999999 8888654443


No 9  
>3odh_A Okrai endonuclease; alpha and beta proteins (A/B), restriction endonuclease-like phosphodiesterase; HET: DNA; 2.30A {Oceanobacter kriegii}
Probab=4.81  E-value=2.8e+02  Score=23.98  Aligned_cols=19  Identities=21%  Similarity=0.087  Sum_probs=15.7

Q ss_pred             ccccccccccCCCCCCccc
Q psy16518        101 KAQIDLSSKINQGTNKVPS  119 (283)
Q Consensus       101 ~gVKD~g~~iP~G~gg~ld  119 (283)
                      .++.++.+.||.|+||..-
T Consensus       175 d~~~~~~p~i~KGtDGra~  193 (194)
T 3odh_A          175 DSVDAQVSLIPKGTDGRAI  193 (194)
T ss_dssp             SEECTTSCCCCCCCCTTSC
T ss_pred             cccccCCCcccCCCCcccc
Confidence            4677788999999999764


No 10 
>1qd6_C Protein (outer membrane phospholipase (ompla)); anti-parallel beta barrel dimer, membrane protein; HET: HDS; 2.10A {Escherichia coli} SCOP: f.4.2.1
Probab=4.68  E-value=1.4e+02  Score=26.71  Aligned_cols=8  Identities=88%  Similarity=1.655  Sum_probs=5.4

Q ss_pred             ehhhHHHH
Q psy16518        269 YGESLVDY  276 (283)
Q Consensus       269 ~~~~~~~~  276 (283)
                      |||||-||
T Consensus       216 YGESLiDY  223 (240)
T 1qd6_C          216 YGESLIDY  223 (240)
T ss_dssp             ECSSGGGT
T ss_pred             cCcchhhh
Confidence            67777665


Done!