Query         psy16523
Match_columns 85
No_of_seqs    107 out of 425
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 23:27:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16523.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16523hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01130 CD36:  CD36 family;  I  99.9 1.4E-25   3E-30  176.4   9.5   76    1-82     43-118 (467)
  2 KOG3776|consensus               99.9 9.7E-22 2.1E-26  158.7   8.0   75    1-82     54-129 (507)
  3 PF02056 Glyco_hydro_4:  Family  26.5      40 0.00087   24.3   1.4   13   13-25    138-150 (183)
  4 PF09200 Monellin:  Monellin;    21.0      51  0.0011   18.8   0.8   19   33-51      4-23  (43)
  5 PF00407 Bet_v_1:  Pathogenesis  20.7 2.7E+02  0.0059   18.9   4.6   38   23-66     42-85  (151)
  6 PF05981 CreA:  CreA protein;    19.8 1.6E+02  0.0035   20.4   3.3   43   31-78     55-97  (128)
  7 PRK15076 alpha-galactosidase;   17.5      81  0.0018   25.3   1.6   15   12-26    140-154 (431)
  8 PHA02757 hypothetical protein;  16.2 1.1E+02  0.0024   19.3   1.6   20   23-43      4-28  (75)
  9 PF14237 DUF4339:  Domain of un  16.1      65  0.0014   17.5   0.5   13   35-47      9-21  (45)
 10 PF08341 Fb_signal:  Fibronecti  15.8      67  0.0015   19.8   0.6   17   66-84     26-42  (72)

No 1  
>PF01130 CD36:  CD36 family;  InterPro: IPR002159 CD36 is a transmembrane, highly glycosylated, 88kDa glycoprotein expressed by monocytes, macrophages, platelets, microvascular endothelial cells and adipose tissues. Platelet glycoprotein IV (GP IV)(GPIIIb) (CD36 antigen) is also called GPIV, OKM5-antigen or PASIV. CD36 recognises oxidized low density lipoprotein, long chain fatty acids, anionic phospholipids, collagen types I, IV and V, thrombospondin (TSP) and Plasmodium falciparum infected erythrocytes. The recognition of apoptotic neutrophils is in co-operation with TSP and avb3. Other ligands may still be unknown. CD36 is a scavenger receptor for oxidized LDL and shed photoreceptor outer segments and in recognition and phagocytosis of apoptotic cells and is the cell adhesion molecule in platelet adhesion and aggregation, platelet-monocyte and platelet-tumor cell interaction []. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0007155 cell adhesion, 0016020 membrane
Probab=99.93  E-value=1.4e-25  Score=176.44  Aligned_cols=76  Identities=33%  Similarity=0.628  Sum_probs=71.7

Q ss_pred             CccCCCCcceEEEEEEeccChhhhhcCCCCCceeEEeCCeEEEeEEEeeeeEEecCCCcCceEEEEcceEEEEEeeceee
Q psy16523          1 MWRKPPVHPVIRIFIYNVTNADEFLSVPGTKPVLDEIGPYVYVLLTSFVANVIQVNKLERNSMTWSGLGFYCCLFNMELR   80 (85)
Q Consensus         1 ~W~~pp~~~~~~~y~FNvTN~eevl~g~g~kP~v~EvGPY~Y~e~~~k~ni~~~~n~~e~~t~~y~~~~~y~~~~~~~~~   80 (85)
                      .|++||+|++++||+||||||+||++| |+||+|+|+|||+|+|.++|+|++|++|+   +||+|++++.|.  |+.|.|
T Consensus        43 ~W~~~p~p~~~~~y~fNvTNp~ev~~~-g~kP~~~EvGPY~y~e~~~k~nv~~~~~~---~tvsY~~~~~~~--F~~~~S  116 (467)
T PF01130_consen   43 NWKKPPVPIYFKFYFFNVTNPEEVLNG-GAKPNVQEVGPYVYREYREKVNVTFNDNG---STVSYRQKRTFF--FDPELS  116 (467)
T ss_pred             hhhcCCCccEEEEEEEeccCHHHHhCc-CCCceEEEeCCEEEEeeeeeeeeEEcCCC---cEEEEEeeeeEE--eccccC
Confidence            599999999999999999999999996 99999999999999999999999998873   799999999996  999988


Q ss_pred             ec
Q psy16523         81 WS   82 (85)
Q Consensus        81 ~~   82 (85)
                      -.
T Consensus       117 ~~  118 (467)
T PF01130_consen  117 CG  118 (467)
T ss_pred             CC
Confidence            65


No 2  
>KOG3776|consensus
Probab=99.86  E-value=9.7e-22  Score=158.68  Aligned_cols=75  Identities=37%  Similarity=0.622  Sum_probs=67.0

Q ss_pred             CccCCCCcceEEEEEEeccChhhhhcCCCCCceeEEeCCeEEEeEEEeeeeEEecCCCcCceEEEEc-ceEEEEEeecee
Q psy16523          1 MWRKPPVHPVIRIFIYNVTNADEFLSVPGTKPVLDEIGPYVYVLLTSFVANVIQVNKLERNSMTWSG-LGFYCCLFNMEL   79 (85)
Q Consensus         1 ~W~~pp~~~~~~~y~FNvTN~eevl~g~g~kP~v~EvGPY~Y~e~~~k~ni~~~~n~~e~~t~~y~~-~~~y~~~~~~~~   79 (85)
                      .|.+||++.+++||+|||||||||++| |+||+|+|+|||+|+|.+.|+|+.+.+    |+|++|.+ ++.|.  ||.|.
T Consensus        54 ~W~~pp~~~~~~~yiFNvTNpde~~~~-~~kp~v~EvGPyvy~E~~~K~~~~f~~----n~tv~f~~~~k~~~--F~p~~  126 (507)
T KOG3776|consen   54 SWLNPPYPIYLNFYIFNVTNPDEFLSG-GAKPNVQEVGPYVYREIEQKVNIDFNE----NNTVSFYQNRKTYV--FNPEE  126 (507)
T ss_pred             hhhcCCCccEEEEEEEecCCHHHhhCc-CCCCceEeeCCeEEEEEecccceeecc----CCcEEEEeeccEEE--echhh
Confidence            599999999999999999999999996 999999999999999999999995555    47777777 99996  99987


Q ss_pred             eec
Q psy16523         80 RWS   82 (85)
Q Consensus        80 ~~~   82 (85)
                      |-.
T Consensus       127 S~~  129 (507)
T KOG3776|consen  127 SVG  129 (507)
T ss_pred             cCC
Confidence            743


No 3  
>PF02056 Glyco_hydro_4:  Family 4 glycosyl hydrolase;  InterPro: IPR001088 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 4 GH4 from CAZY comprises enzymes with several known activities; 6-phospho-beta-glucosidase (3.2.1.86 from EC); 6-phospho-alpha-glucosidase (3.2.1.122 from EC); alpha-galactosidase (3.2.1.22 from EC). 6-phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity [].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1U8X_X 1S6Y_A 3FEF_B 1VJT_A 1UP4_A 1UP6_C 1UP7_E 1OBB_A.
Probab=26.45  E-value=40  Score=24.30  Aligned_cols=13  Identities=23%  Similarity=0.340  Sum_probs=10.1

Q ss_pred             EEEEeccChhhhh
Q psy16523         13 IFIYNVTNADEFL   25 (85)
Q Consensus        13 ~y~FNvTN~eevl   25 (85)
                      -|++|.|||...+
T Consensus       138 Aw~iNytNP~~~v  150 (183)
T PF02056_consen  138 AWLINYTNPMGIV  150 (183)
T ss_dssp             SEEEE-SSSHHHH
T ss_pred             cEEEeccChHHHH
Confidence            4899999998775


No 4  
>PF09200 Monellin:  Monellin;  InterPro: IPR015283 Monellin, a protein produced by the West African plant Dioscoreophyllum cumminsii (Serendipity berry), is approximately 70,000 times sweeter than sucrose on a molar basis. The protein adopts an alpha-beta structure, with a cystatin-like fold, where each helix packs against a coiled antiparallel beta-sheet []. ; PDB: 3PXM_A 1IV7_A 3PYJ_A 1KRL_D 4MON_B 2O9U_X 3Q2P_C 3MON_F 1MOL_B 1IV9_A ....
Probab=20.97  E-value=51  Score=18.82  Aligned_cols=19  Identities=21%  Similarity=-0.080  Sum_probs=12.2

Q ss_pred             eeEEeCCeEEEe-EEEeeee
Q psy16523         33 VLDEIGPYVYVL-LTSFVAN   51 (85)
Q Consensus        33 ~v~EvGPY~Y~e-~~~k~ni   51 (85)
                      ..-|.|||+|.. ..-|-+|
T Consensus         4 ~~~e~~~~~~~s~~L~r~~i   23 (43)
T PF09200_consen    4 KGYEYQLYVYASDKLFRADI   23 (43)
T ss_dssp             EEEECCCCEEECCCCCCCCC
T ss_pred             eEEEeeeeeehhhhhhheec
Confidence            456899999963 3344444


No 5  
>PF00407 Bet_v_1:  Pathogenesis-related protein Bet v I family;  InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Aln g 1, Api g 1, Bet v 1, Car b 1, Cor a 1, Dau c 1, Mal d 1 and Pru a 1.  Trees within the order Fagales possess particularly potent allergens, e.g. Bet v1, the major White Birch (Betula verrucosa) pollen antigen. Bet v1 is the main cause of type I allergies observed in early spring. Type I, or immunoglobulin E-mediated (IgE-mediated) allergies affect 1 in 5 people in Europe and North America. Commonly-observed symptoms are hay fever, dermatitis, asthma and, in severe cases, anaphylactic shock. First contact with these allergens results in sensitisation; subsequent contact produces a cross-linking reaction of IgE on mast cells and concomitant release of histamine. The inevitable symptoms of an allergic reaction ensue. Recent NMR analysis [] has confirmed earlier predictions of the protein structure and site of the major T-cell epitope []. The Bet v1 protein comprises 6 anti-parallel beta-strands and 3 alpha-helices. Four of the strands dominate the global fold, and 2 of the helices form a C-terminal amphipathic helical motif. This motif is believed to be the T-cell epitope. Other proteins belonging to this family include the major pollen allergens:  Aln g I from Alnus glutinosa (Alder); Api G I from Apium graveolens (Celery); Car b I from Carpinus betulus (European hornbeam); Cor a I from Corylus avellana (European hazel); Mal d I from Malus domestica (Apple).  The motif is also found in:   the wound-induced protein AoPR1 from Asparagus officinalis (Garden asparagus); pathogenesis-related proteins from Phaseolus vulgaris (Kidney bean) and Petroselinum crispum (Parsley) (PR1-1 and PR1-3); the disease resistance response proteins, STH-2 and STH-21, from Solanum tuberosum (Potato) and pI49, pI176 and DRRG49-C from Pisum sativum (Garden pea);  the P. sativum abscisic acid-responsive proteins ABR17 and ABR18;  and the stress-induced protein SAM22 from Glycine max (Soybean).  ; GO: 0006952 defense response, 0009607 response to biotic stimulus; PDB: 1IFV_A 4A8V_A 4A8U_A 2K7H_A 2QIM_A 3E85_A 1H2O_A 1E09_A 1QMR_A 1FSK_D ....
Probab=20.70  E-value=2.7e+02  Score=18.93  Aligned_cols=38  Identities=21%  Similarity=0.364  Sum_probs=21.6

Q ss_pred             hhhcCCCCCc-e-----eEEeCCeEEEeEEEeeeeEEecCCCcCceEEEE
Q psy16523         23 EFLSVPGTKP-V-----LDEIGPYVYVLLTSFVANVIQVNKLERNSMTWS   66 (85)
Q Consensus        23 evl~g~g~kP-~-----v~EvGPY~Y~e~~~k~ni~~~~n~~e~~t~~y~   66 (85)
                      |++.|.|... .     +-+-||..|  .++|++.  .|+  ++.+++|+
T Consensus        42 e~~eGdgg~gGSIk~~~f~~~~~~~~--~Kekve~--~D~--~~~~~~y~   85 (151)
T PF00407_consen   42 EVVEGDGGPGGSIKKWTFGPGGPFKY--VKEKVEA--IDE--ENKTITYT   85 (151)
T ss_dssp             EEEESSSSTTT-EEEEEEETTSSEEE--EEEEEEE--EET--TTTEEEEE
T ss_pred             EEEccCCCCCCeEEEEEecCCCCcce--eEEEEEe--ecC--CCcEEEEE
Confidence            4455555544 3     334488644  5777665  233  36888886


No 6  
>PF05981 CreA:  CreA protein;  InterPro: IPR010292 This family consists of several bacterial CreA proteins, the function of which is unknown.
Probab=19.79  E-value=1.6e+02  Score=20.41  Aligned_cols=43  Identities=12%  Similarity=0.145  Sum_probs=28.5

Q ss_pred             CceeEEeCCeEEEeEEEeeeeEEecCCCcCceEEEEcceEEEEEeece
Q psy16523         31 KPVLDEIGPYVYVLLTSFVANVIQVNKLERNSMTWSGLGFYCCLFNME   78 (85)
Q Consensus        31 kP~v~EvGPY~Y~e~~~k~ni~~~~n~~e~~t~~y~~~~~y~~~~~~~   78 (85)
                      ...-+|.||.+..+...+-..+|..    ..++-|+..+... +||++
T Consensus        55 SisCrQtGpI~~~~~~~~ge~VF~e----~~Sl~FK~l~V~R-i~D~~   97 (128)
T PF05981_consen   55 SISCRQTGPITIKDKSPKGEEVFSE----SKSLLFKSLRVVR-IYDAK   97 (128)
T ss_pred             eEEEEEeccEeeCCCCCCcCeeEec----ccceeeeeEEEEE-EEcCC
Confidence            3457899999998766666666654    3667776666654 45543


No 7  
>PRK15076 alpha-galactosidase; Provisional
Probab=17.54  E-value=81  Score=25.31  Aligned_cols=15  Identities=13%  Similarity=0.171  Sum_probs=12.8

Q ss_pred             EEEEEeccChhhhhc
Q psy16523         12 RIFIYNVTNADEFLS   26 (85)
Q Consensus        12 ~~y~FNvTN~eevl~   26 (85)
                      +-++.|+|||.+++.
T Consensus       140 ~a~iin~tNP~divt  154 (431)
T PRK15076        140 DALLLNYVNPMAMNT  154 (431)
T ss_pred             CeEEEEcCChHHHHH
Confidence            568999999998873


No 8  
>PHA02757 hypothetical protein; Provisional
Probab=16.16  E-value=1.1e+02  Score=19.28  Aligned_cols=20  Identities=40%  Similarity=0.788  Sum_probs=15.5

Q ss_pred             hhhcCCCCCc-----eeEEeCCeEEE
Q psy16523         23 EFLSVPGTKP-----VLDEIGPYVYV   43 (85)
Q Consensus        23 evl~g~g~kP-----~v~EvGPY~Y~   43 (85)
                      |+|.| .+||     .+.-.||+-|.
T Consensus         4 EflkG-SskPprnvCViTPsgpfDFn   28 (75)
T PHA02757          4 EFLKG-SSKPPRNVCVITPSGPFDFN   28 (75)
T ss_pred             hhhcC-CCCCCCCEEEEeCCCCccEE
Confidence            68886 6676     47788999987


No 9  
>PF14237 DUF4339:  Domain of unknown function (DUF4339)
Probab=16.08  E-value=65  Score=17.51  Aligned_cols=13  Identities=23%  Similarity=0.470  Sum_probs=10.2

Q ss_pred             EEeCCeEEEeEEE
Q psy16523         35 DEIGPYVYVLLTS   47 (85)
Q Consensus        35 ~EvGPY~Y~e~~~   47 (85)
                      ++.|||+..+-+.
T Consensus         9 ~~~GP~s~~el~~   21 (45)
T PF14237_consen    9 QQQGPFSLEELRQ   21 (45)
T ss_pred             eEECCcCHHHHHH
Confidence            6899999877554


No 10 
>PF08341 Fb_signal:  Fibronectin-binding protein signal sequence;  InterPro: IPR013552 This domain is found near the N terminus of fibronectin-binding proteins in Streptococcus where it functions as a signal sequence []. ; PDB: 2XI9_A 2XID_B 2XIC_B.
Probab=15.84  E-value=67  Score=19.84  Aligned_cols=17  Identities=35%  Similarity=0.853  Sum_probs=0.0

Q ss_pred             EcceEEEEEeeceeeeccc
Q psy16523         66 SGLGFYCCLFNMELRWSLT   84 (85)
Q Consensus        66 ~~~~~y~~~~~~~~~~~~~   84 (85)
                      +...+||  ||....||.+
T Consensus        26 ~~~~VYC--FN~~~~~P~~   42 (72)
T PF08341_consen   26 KSYQVYC--FNRDKHWPET   42 (72)
T ss_dssp             -EEEEEE--S-TTSB-S-E
T ss_pred             ceEEEEE--cCCcCCCCCc


Done!