RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16528
         (82 letters)



>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended
          (e) SDRs.  SDRs are Rossmann-fold NAD(P)H-binding
          proteins, many of which may function as fatty acyl CoA
          reductases (FAR), acting on medium and long chain fatty
          acids, and have been reported to be involved in diverse
          processes such as biosynthesis of insect pheromones,
          plant cuticular wax production, and mammalian wax
          biosynthesis. In Arabidopsis thaliana, proteins with
          this particular architecture have also been identified
          as the MALE STERILITY 2 (MS2) gene product, which is
          implicated in male gametogenesis. Mutations in MS2
          inhibit the synthesis of exine (sporopollenin),
          rendering plants unable to reduce pollen wall fatty
          acids to corresponding alcohols. This N-terminal domain
          shares the catalytic triad (but not the upstream Asn)
          and characteristic NADP-binding motif of the extended
          SDR family. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 320

 Score = 89.7 bits (223), Expect = 2e-23
 Identities = 32/54 (59%), Positives = 39/54 (72%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPL 80
          +SV +TG TGF+GKVL+EKLLRSCP I  IYLL+R K GQ    RL E++   L
Sbjct: 1  KSVLITGATGFLGKVLLEKLLRSCPDIGKIYLLIRGKSGQSAEERLRELLKDKL 54


>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein.  This family
          represents the C-terminal region of the male sterility
          protein in a number of arabidopsis and drosophila. A
          sequence-related jojoba acyl CoA reductase is also
          included.
          Length = 245

 Score = 71.5 bits (176), Expect = 6e-17
 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 1/44 (2%)

Query: 31 VTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAE 74
          +TG TGF+GKVL+EKLLRS P +K IY L+R K G+    RL +
Sbjct: 1  LTGATGFLGKVLLEKLLRSTPEVK-IYCLVRAKDGESALERLRQ 43


>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2.
          Length = 605

 Score = 62.2 bits (151), Expect = 4e-13
 Identities = 26/62 (41%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 20  VSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLA-EIINA 78
           ++EF + ++  +TG TGF+ KVL+EK+LR+ P +  IYLL++ K  +    RL  E+I+A
Sbjct: 113 IAEFLRGKNFLITGATGFLAKVLIEKILRTNPDVGKIYLLIKAKDKEAAIERLKNEVIDA 172

Query: 79  PL 80
            L
Sbjct: 173 EL 174


>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase.
          Length = 491

 Score = 58.2 bits (141), Expect = 9e-12
 Identities = 20/42 (47%), Positives = 31/42 (73%)

Query: 20 VSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR 61
            +F +N+++ VTG TGF+ K+ VEK+LR  P +K +YLL+R
Sbjct: 5  CVQFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLR 46


>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like,
          extended (e) SDRs.  This subgroup of extended SDR
          family domains have the characteristic active site
          tetrad and a well-conserved NAD(P)-binding motif. This
          subgroup is not well characterized, its members are
          annotated as having a variety of putative functions.
          One characterized member is Pseudomonas fluorescens
          MupV a protein  involved in the biosynthesis of
          Mupirocin, a polyketide-derived antibiotic. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 293

 Score = 44.7 bits (106), Expect = 5e-07
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 3/46 (6%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAE 74
          VFVTGGTGF+G+ LV++LL +      + +L+R +   + + R+ E
Sbjct: 1  VFVTGGTGFLGRHLVKRLLEN---GFKVLVLVRSESLGEAHERIEE 43


>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional.
          Length = 657

 Score = 43.8 bits (104), Expect = 1e-06
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 30 FVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEII 76
          FVTGGTGF+G+ LV +LL        +++L+R +       RL  + 
Sbjct: 4  FVTGGTGFIGRRLVSRLLDRRREAT-VHVLVRRQS----LSRLEALA 45


>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1.  This family
          consists of an SDR module of multidomain proteins
          identified as putative polyketide sythases fatty acid
          synthases (FAS), and nonribosomal peptide synthases,
          among others. However, unlike the usual ketoreductase
          modules of FAS and polyketide synthase, these domains
          are related to the extended SDRs, and have canonical
          NAD(P)-binding motifs and an active site tetrad.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 290

 Score = 40.3 bits (95), Expect = 2e-05
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINA 78
          +V +TG TGF+G  L+ +LL+    +  IY L+R K  +    RL + +  
Sbjct: 1  TVLLTGATGFLGAYLLRELLK-RKNVSKIYCLVRAKDEEAALERLIDNLKE 50


>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of
          multifunctional non-ribosomal peptide synthetases and
          related enzymes [Secondary metabolites biosynthesis,
          transport, and catabolism].
          Length = 382

 Score = 39.7 bits (93), Expect = 3e-05
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRL 72
          R+V +TG TGF+G  L+ +LL        +  L+R +  +    RL
Sbjct: 1  RNVLLTGATGFLGAYLLLELLDRSDA--KVICLVRAQSDEAALARL 44


>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde
          reductase and flavonoid reductase related proteins,
          extended (e) SDRs.  This subgroup contains proteins of
          unknown function related to aldehyde reductase and
          flavonoid reductase of the extended SDR-type. Aldehyde
          reductase I (aka carbonyl reductase) is an NADP-binding
          SDR; it has an NADP-binding motif consensus that is
          slightly different from the canonical SDR form and
          lacks the Asn of the extended SDR active site tetrad.
          Aldehyde reductase I catalyzes the NADP-dependent
          reduction of ethyl 4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. The related flavonoid
          reductases act in the NADP-dependent reduction of
          flavonoids, ketone-containing plant secondary
          metabolites. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 318

 Score = 38.8 bits (91), Expect = 7e-05
 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 9/54 (16%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW 82
          + VTG TGF+G  LV  LL    G + +  L+R             +   P++ 
Sbjct: 1  ILVTGATGFLGSNLVRALLAQ--GYR-VRALVRSGS------DAVLLDGLPVEV 45


>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain.  This
          model includes the terminal domain from the fungal
          alpha aminoadipate reductase enzyme (also known as
          aminoadipate semialdehyde dehydrogenase) which is
          involved in the biosynthesis of lysine , as well as the
          reductase-containing component of the myxochelin
          biosynthetic gene cluster, MxcG. The mechanism of
          reduction involves activation of the substrate by
          adenylation and transfer to a covalently-linked
          pantetheine cofactor as a thioester. This thioester is
          then reduced to give an aldehyde (thus releasing the
          product) and a regenerated pantetheine thiol. (In
          myxochelin biosynthesis this aldehyde is further
          reduced to an alcohol or converted to an amine by an
          aminotransferase.) This is a fundamentally different
          reaction than beta-ketoreductase domains of polyketide
          synthases which act at a carbonyl two carbons removed
          from the thioester and forms an alcohol as a product.
          This domain is invariably found at the C-terminus of
          the proteins which contain it (presumably because it
          results in the release of the product). The majority of
          hits to this model are non-ribosomal peptide
          synthetases in which this domain is similarly located
          proximal to a thiolation domain (pfam00550). In some
          cases this domain is found at the end of a polyketide
          synthetase enzyme, but is unlike ketoreductase domains
          which are found before the thiolase domains. Exceptions
          to this observed relationship with the thiolase domain
          include three proteins which consist of stand-alone
          reductase domains (GP|466833 from M. leprae, GP|435954
          from Anabaena and OMNI|NTL02SC1199 from Strep.
          coelicolor) and one protein (OMNI|NTL01NS2636 from
          Nostoc) which contains N-terminal homology with a small
          group of hypothetical proteins but no evidence of a
          thiolation domain next to the putative reductase
          domain. Below the noise cutoff to this model are
          proteins containing more distantly related
          ketoreductase and dehydratase/epimerase domains. It has
          been suggested that a NADP-binding motif can be found
          in the N-terminal portion of this domain that may form
          a Rossman-type fold.
          Length = 367

 Score = 37.8 bits (88), Expect = 1e-04
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR---PKHGQD 67
          +V +TG TGF+G  L+E+LLR     K +  L+R    +H  +
Sbjct: 1  TVLLTGATGFLGAYLLEELLRRSTQAK-VICLVRAASEEHAME 42


>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7.  This subgroup
          contains atypical SDRs of unknown function. Members of
          this subgroup have a glycine-rich NAD(P)-binding motif
          consensus that matches the extended SDRs, TGXXGXXG, but
          lacks the characteristic active site residues of the
          SDRs. This subgroup has basic residues (HXXXR) in place
          of the active site motif YXXXK, these may have a
          catalytic role. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 291

 Score = 36.9 bits (86), Expect = 3e-04
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 29 VFVTGGTGFMGKVLVEKLL 47
          VFVTG TGF+G  +V +L+
Sbjct: 3  VFVTGATGFIGSAVVRELV 21


>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase. 
            Members of this protein family are
            L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31),
            product of the LYS2 gene. It is also called
            alpha-aminoadipate reductase. In fungi, lysine is
            synthesized via aminoadipate. Currently, all members of
            this family are fungal.
          Length = 1389

 Score = 37.0 bits (86), Expect = 3e-04
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 4    NNVPTISSNMPA--PSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLL--RSCPGIKNIYLL 59
             +  T+  ++P   PS    +     +VF+TG TGF+G  ++  LL  RS    K ++  
Sbjct: 947  KDAKTLVDSLPKSYPSRKELDASTPITVFLTGATGFLGSFILRDLLTRRSNSNFK-VFAH 1005

Query: 60   MRPK 63
            +R K
Sbjct: 1006 VRAK 1009


>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell
          envelope biogenesis, outer membrane / Carbohydrate
          transport and metabolism].
          Length = 314

 Score = 36.8 bits (85), Expect = 3e-04
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLD 81
          + VTGG GF+G  LVE+LL +     ++  L R + G D      E +   L 
Sbjct: 3  ILVTGGAGFIGSHLVERLLAAGH---DVRGLDRLRDGLDPLLSGVEFVVLDLT 52


>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs.  Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 200

 Score = 36.5 bits (85), Expect = 4e-04
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          + VTGG GF+G  LV +LL 
Sbjct: 1  ILVTGGAGFIGSHLVRRLLE 20


>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases
           [Cell envelope biogenesis, outer membrane / Carbohydrate
           transport and metabolism].
          Length = 588

 Score = 36.1 bits (84), Expect = 6e-04
 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 3/62 (4%)

Query: 19  PVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQ-DINGRLAEIIN 77
            +      ++V VTGG G +G  L  ++L+     K I L  R ++    I+  L E   
Sbjct: 243 LIGAMLTGKTVLVTGGGGSIGSELCRQILKF--NPKEIILFSRDEYKLYLIDMELREKFP 300

Query: 78  AP 79
             
Sbjct: 301 EL 302


>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended
          (e) SDRs.  This subgroup contains CDP-D-glucose
          4,6-dehydratase, an extended SDR, which catalyzes the
          conversion of CDP-D-glucose to
          CDP-4-keto-6-deoxy-D-glucose. This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 336

 Score = 36.1 bits (84), Expect = 6e-04
 Identities = 12/25 (48%), Positives = 14/25 (56%)

Query: 23 FYQNRSVFVTGGTGFMGKVLVEKLL 47
          F+Q + V VTG TGF G  L   L 
Sbjct: 1  FWQGKRVLVTGHTGFKGSWLSLWLQ 25


>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family.
           This family of proteins utilise NAD as a cofactor. The
          proteins in this family use nucleotide-sugar substrates
          for a variety of chemical reactions.
          Length = 233

 Score = 34.6 bits (80), Expect = 0.002
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRL 72
          + VTGGTGF+G  LV +LL+   G + I L  R +      GR+
Sbjct: 1  ILVTGGTGFIGSHLVRRLLQE--GYEVIVLGRRRRSESLNTGRI 42


>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase.  Members
          of this protein family are CDP-glucose 4,6-dehydratase
          from a variety of Gram-negative and Gram-positive
          bacteria. Members typically are encoded next to a gene
          that encodes a glucose-1-phosphate
          cytidylyltransferase, which produces the substrate,
          CDP-D-glucose, used by this enzyme to produce
          CDP-4-keto-6-deoxyglucose [Cell envelope, Biosynthesis
          and degradation of surface polysaccharides and
          lipopolysaccharides].
          Length = 349

 Score = 33.8 bits (78), Expect = 0.003
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 23 FYQNRSVFVTGGTGFMGKVLV 43
          F+Q + V VTG TGF G  L 
Sbjct: 1  FWQGKKVLVTGHTGFKGSWLS 21


>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked
          N-acetylglucosamine) inverting 4,6-dehydratase,
          extended (e) SDRs.  UDP-Glcnac inverting
          4,6-dehydratase was identified in Helicobacter pylori
          as the hexameric flaA1 gene product (FlaA1). FlaA1 is
          hexameric, possesses UDP-GlcNAc-inverting
          4,6-dehydratase activity,  and catalyzes the first step
          in the creation of a pseudaminic acid derivative in
          protein glycosylation. Although this subgroup has the
          NADP-binding motif characteristic of extended SDRs, its
          members tend to have a Met substituted for the active
          site Tyr found in most SDR families. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 287

 Score = 33.7 bits (78), Expect = 0.004
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 26 NRSVFVTGGTGFMGKVLVEKLLRSCPG 52
           +++ VTGG G +G  LV ++L+  P 
Sbjct: 2  GKTILVTGGAGSIGSELVRQILKFGPK 28


>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase.
          Length = 367

 Score = 33.6 bits (77), Expect = 0.004
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 26 NRSVFVTGGTGFMGKVLVEKLLR 48
           R V VTGG  F+G  +V++LLR
Sbjct: 53 ARLVCVTGGVSFLGLAIVDRLLR 75


>gnl|CDD|215072 PLN00141, PLN00141, Tic62-NAD(P)-related group II protein;
          Provisional.
          Length = 251

 Score = 32.9 bits (75), Expect = 0.007
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 17 STPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIK 54
          S   +E  + ++VFV G TG  GK +VE+LL     +K
Sbjct: 8  SEEDAENVKTKTVFVAGATGRTGKRIVEQLLAKGFAVK 45


>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase.  This
          enzyme catalyzes the first step in the biosynthesis of
          pseudaminic acid, the conversion of
          UDP-N-acetylglucosamine to
          UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences
          are members of the broader pfam01073 (3-beta
          hydroxysteroid dehydrogenase/isomerase family) family.
          Length = 324

 Score = 32.8 bits (75), Expect = 0.009
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 23 FYQNRSVFVTGGTGFMGKVLVEKLL 47
           + N+S+ +TGGTG  GK  + +LL
Sbjct: 1  MFNNKSILITGGTGSFGKAFISRLL 25


>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1
          alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like,
          atypical (a) SDRs.  This subgroup of extended SDR-like
          proteins are atypical SDRs. They have a glycine-rich
          NAD(P)-binding motif similar to the typical SDRs,
          GXXGXXG, and have the YXXXK active site motif (though
          not the other residues of the SDR tetrad). Members
          identified include NDUFA9 (mitochondrial) and putative
          nucleoside-diphosphate-sugar epimerase. Atypical SDRs
          generally lack the catalytic residues characteristic of
          the SDRs, and their glycine-rich NAD(P)-binding motif
          is often different from the forms normally seen in
          classical or extended SDRs. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 273

 Score = 32.6 bits (75), Expect = 0.011
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 29 VFVTGGTGFMGKVLVEKLLRS 49
          V V G TGF+G+ +V +L + 
Sbjct: 3  VTVFGATGFIGRYVVNRLAKR 23


>gnl|CDD|187582 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatty acid synthase
           (FAS), complex (x) SDRs.  Ketoreductase, a module of the
           multidomain polyketide synthase (PKS), has 2 subdomains,
           each corresponding  to a SDR family monomer. The
           C-terminal subdomain catalyzes the NADPH-dependent
           reduction of the beta-carbonyl of a polyketide to a
           hydroxyl group, a step in the biosynthesis of
           polyketides, such as erythromycin. The N-terminal
           subdomain, an interdomain linker, is a truncated
           Rossmann fold which acts to stabilizes the catalytic
           subdomain. Unlike typical SDRs, the isolated domain does
           not oligomerize but is composed of 2 subdomains, each
           resembling an SDR monomer. The active site resembles
           that of typical SDRs, except that the usual positions of
           the catalytic Asn and Tyr are swapped, so that the
           canonical YXXXK motif changes to YXXXN. Modular PKSs are
           multifunctional structures in which the makeup
           recapitulates that found in (and may have evolved from)
           FAS.  In some instances, such as porcine FAS, an enoyl
           reductase (ER) module is inserted between the
           sub-domains. Fatty acid synthesis occurs via the
           stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consist of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthase
           uses a dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles, ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-KR, forming beta-hydroxyacyl-ACP, which is in turn
           dehydrated by dehydratase to a beta-enoyl intermediate,
           which is reduced by NADP-dependent beta-ER. Polyketide
           synthesis also proceeds via the addition of 2-carbon
           units as in fatty acid synthesis. The complex SDR
           NADP-binding motif, GGXGXXG, is often present, but is
           not strictly conserved in each instance of the module.
           SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 375

 Score = 32.4 bits (74), Expect = 0.013
 Identities = 12/51 (23%), Positives = 21/51 (41%), Gaps = 2/51 (3%)

Query: 24  YQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAE 74
             + +  +TGG G +G ++   L     G +++ LL R         R A 
Sbjct: 148 GLDGTYLITGGLGGLGLLVARWLAAR--GARHLVLLSRRGPAPRAAARAAL 196


>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases
          (3b-HSD)-like, extended (e) SDRs.  Extended SDR family
          domains belonging to this subgroup have the
          characteristic active site tetrad and a fairly
          well-conserved NAD(P)-binding motif. 3b-HSD catalyzes
          the NAD-dependent conversion of various steroids, such
          as pregnenolone to progesterone, or androstenediol to
          testosterone. This subgroup includes an unusual
          bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis
          thaliana, and Saccharomyces cerevisiae ERG26, a
          3b-HSD/C-4 decarboxylase, involved in the synthesis of
          ergosterol, the major sterol of yeast. It also includes
          human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7].  C(27) 3beta-HSD/HSD3B7 is a membrane-bound
          enzyme of the endoplasmic reticulum, that catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human NSDHL (NAD(P)H
          steroid dehydrogenase-like protein) cause CHILD
          syndrome (congenital hemidysplasia with ichthyosiform
          nevus and limb defects), an X-linked dominant,
          male-lethal trait. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 331

 Score = 32.0 bits (73), Expect = 0.015
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 28 SVFVTGGTGFMGKVLVEKLLR 48
          SV VTGG+GF G+ LV++LL 
Sbjct: 1  SVLVTGGSGFFGERLVKQLLE 21


>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid
          dehydrogenase) and HSD3B1(delta 5-delta
          4-isomerase)-like, extended (e) SDRs.  This
          extended-SDR subgroup includes human 3 beta-HSD/HSD3B1
          and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7], and related proteins. These proteins have the
          characteristic active site tetrad and NAD(P)-binding
          motif of extended SDRs. 3 beta-HSD catalyzes the
          oxidative conversion of delta 5-3 beta-hydroxysteroids
          to the delta 4-3-keto configuration; this activity is
          essential for the biosynthesis of all classes of
          hormonal steroids. C(27) 3beta-HSD is a membrane-bound
          enzyme of the endoplasmic reticulum, it catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 354

 Score = 32.1 bits (73), Expect = 0.019
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLL 59
             VTGG GF+G+ ++  LL     +K I +L
Sbjct: 1  VCLVTGGGGFLGQHIIRLLLERKEELKEIRVL 32


>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1.  Atypical SDRs in
          this subgroup are poorly defined and have been
          identified putatively as isoflavones reductase, sugar
          dehydratase, mRNA binding protein etc. Atypical SDRs
          are distinct from classical SDRs. Members of this
          subgroup retain the canonical active site triad (though
          not the upstream Asn found in most SDRs) but have an
          unusual putative glycine-rich NAD(P)-binding motif,
          GGXXXXG, in the usual location. Atypical SDRs generally
          lack the catalytic residues characteristic of the SDRs,
          and their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 250

 Score = 31.9 bits (73), Expect = 0.019
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 27 RSVFVTGGTGFMGKVLVEKLL 47
            + + GGT F+GK LVE+LL
Sbjct: 1  MKILIIGGTRFIGKALVEELL 21


>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          archaeal and bacterial proteins, and has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 305

 Score = 31.9 bits (73), Expect = 0.019
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          + VTGG GF+G  LV++LL 
Sbjct: 2  ILVTGGAGFIGSHLVDRLLE 21


>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid
          dehydrogenase-like protein)-like, extended (e) SDRs.
          This subgroup includes human NSDHL and related
          proteins. These proteins have the characteristic active
          site tetrad of extended SDRs, and also have a close
          match to their  NAD(P)-binding motif.  Human NSDHL is a
          3beta-hydroxysteroid dehydrogenase (3 beta-HSD) which
          functions in the cholesterol biosynthetic pathway.  3
          beta-HSD catalyzes the oxidative conversion of delta
          5-3 beta-hydroxysteroids to the delta 4-3-keto
          configuration; this activity is essential for the
          biosynthesis of all classes of hormonal steroids.
          Mutations in the gene encoding NSDHL cause CHILD
          syndrome (congenital hemidysplasia with ichthyosiform
          nevus and limb defects), an X-linked dominant,
          male-lethal trait.  This subgroup also includes an
          unusual bifunctional [3beta-hydroxysteroid
          dehydrogenase (3b-HSD)/C-4 decarboxylase from
          Arabidopsis thaliana, and Saccharomyces cerevisiae
          ERG26, a 3b-HSD/C-4 decarboxylase, involved in the
          synthesis of ergosterol, the major sterol of yeast.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 335

 Score = 31.6 bits (72), Expect = 0.021
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 28 SVFVTGGTGFMGKVLVEKLLR 48
          S  V GG+GF+G+ LVE+LLR
Sbjct: 1  SCLVVGGSGFLGRHLVEQLLR 21


>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase,
          extended (e) SDRs.  This subgroup contains
          UDP-N-acetylglucosamine 4-epimerase of Pseudomonas
          aeruginosa, WbpP,  an extended SDR, that catalyzes the
          NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to
          UDP-Glc and UDP-Gal.  This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 304

 Score = 31.8 bits (73), Expect = 0.021
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          V VTGG GF+G  LVE+LL 
Sbjct: 2  VLVTGGAGFIGSHLVERLLE 21


>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs.  Extended
          or atypical short-chain dehydrogenases/reductases
          (SDRs, aka tyrosine-dependent oxidoreductases) are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          Atypical SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Atypical
          SDRs include biliverdin IX beta reductase (BVR-B,aka
          flavin reductase), NMRa (a negative transcriptional
          regulator of various fungi), progesterone
          5-beta-reductase like proteins, phenylcoumaran benzylic
          ether and pinoresinol-lariciresinol reductases,
          phenylpropene synthases, eugenol synthase,
          triphenylmethane reductase, isoflavone reductases, and
          others. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 176

 Score = 31.2 bits (71), Expect = 0.028
 Identities = 8/20 (40%), Positives = 13/20 (65%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          + + G TGF+G+ L  +LL 
Sbjct: 1  ILILGATGFIGRALARELLE 20


>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs.  This
          subgroup contains aldehyde reductase of the extended
          SDR-type and related proteins. Aldehyde reductase I
          (aka carbonyl reductase) is an NADP-binding SDR; it has
          an NADP-binding motif consensus that is slightly
          different from the canonical SDR form and lacks the Asn
          of the extended SDR active site tetrad. Aldehyde
          reductase I catalyzes the NADP-dependent  reduction of
          ethyl 4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 301

 Score = 31.5 bits (72), Expect = 0.028
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          V VTG TGF+   +VE+LL+
Sbjct: 2  VLVTGATGFIASHIVEQLLK 21


>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs.
          This subgroup contains FRs of the extended SDR-type and
          related proteins. These FRs act in the NADP-dependent
          reduction of  flavonoids, ketone-containing plant
          secondary metabolites; they have the characteristic
          active site triad of the SDRs (though not the upstream
          active site Asn) and a NADP-binding motif that is very
          similar to the typical extended SDR motif. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 293

 Score = 31.4 bits (72), Expect = 0.029
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          V VTG +GF+G  LV++LL+
Sbjct: 1  VCVTGASGFIGSWLVKRLLQ 20


>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5.  This subgroup
          contains atypical SDRs, some of which are identified as
          putative NAD(P)-dependent epimerases, one as a putative
          NAD-dependent epimerase/dehydratase. Atypical SDRs are
          distinct from classical SDRs. Members of this subgroup
          have a glycine-rich NAD(P)-binding motif that is very
          similar to the extended SDRs, GXXGXXG, and binds NADP.
          Generally, this subgroup has poor conservation of the
          active site tetrad; however, individual sequences do
          contain matches to the YXXXK active site motif, the
          upstream Ser, and there is a highly conserved Asp in
          place of the usual active site Asn throughout the
          subgroup. Atypical SDRs generally lack the catalytic
          residues characteristic of the SDRs, and their
          glycine-rich NAD(P)-binding motif is often different
          from the forms normally seen in classical or extended
          SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 203

 Score = 31.1 bits (71), Expect = 0.030
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR-PKHGQDINGRLAEIINAPLDW 82
           V V G TG +G+ +V +LL    G   +  L+R P   + +    AE++   L  
Sbjct: 1  KVLVVGATGKVGRHVVRELLDR--GY-QVRALVRDPSQAEKLEAAGAEVVVGDLTD 53


>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase.  The
          sequences in this family are members of the pfam01370
          superfamily of NAD-dependent epimerases and
          dehydratases typically acting on nucleotide-sugar
          substrates. The genes of the family modeled here are
          generally in the same locus with genes involved in the
          biosynthesis and elaboration of hopene, the cyclization
          product of the polyisoprenoid squalene. This gene and
          its association with hopene biosynthesis in Zymomonas
          mobilis has been noted in the literature where the gene
          symbol hpnA was assigned. Hopanoids are known to be
          components of the plasma membrane and to have polar
          sugar head groups in Z. mobilis and other species.
          Length = 328

 Score = 31.1 bits (71), Expect = 0.032
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 29 VFVTGGTGFMGKVLVEKLL 47
          V VTG TGF+G  +V  LL
Sbjct: 3  VLVTGATGFVGSAVVRLLL 21


>gnl|CDD|187560 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs.
          Atypical SDRs in this subgroup include CC3 (also known
          as TIP30) which is implicated in tumor suppression.
          Atypical SDRs are distinct from classical SDRs. Members
          of this subgroup have a glycine rich NAD(P)-binding
          motif that resembles the extended SDRs, and have an
          active site triad of the SDRs (YXXXK and upstream Ser),
          although the upstream Asn of the usual SDR active site
          is substituted with Asp. For CC3, the Tyr of the triad
          is displaced compared to the usual SDRs and the protein
          is monomeric, both these observations suggest that the
          usual SDR catalytic activity is not present. NADP
          appears to serve an important role as a ligand, and may
          be important in the interaction with other
          macromolecules. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 214

 Score = 31.1 bits (71), Expect = 0.037
 Identities = 14/56 (25%), Positives = 26/56 (46%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW 82
          ++  V G TG +GK L+ +LL+S    K   ++ R     +   +L +I+      
Sbjct: 1  KTALVLGATGLVGKHLLRELLKSPYYSKVTAIVRRKLTFPEAKEKLVQIVVDFERL 56


>gnl|CDD|233570 TIGR01777, yfcH, TIGR01777 family protein.  This model represents
          a clade of proteins of unknown function including the
          E. coli yfcH protein [Hypothetical proteins,
          Conserved].
          Length = 291

 Score = 31.1 bits (71), Expect = 0.041
 Identities = 9/21 (42%), Positives = 16/21 (76%)

Query: 29 VFVTGGTGFMGKVLVEKLLRS 49
          + +TGGTGF+G+ L ++L + 
Sbjct: 1  ILITGGTGFIGRALTQRLTKR 21


>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated.
          Length = 238

 Score = 30.6 bits (70), Expect = 0.044
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLL 47
          + + V VTG    +G+  VE+LL
Sbjct: 5  KGKVVLVTGANRGIGRAFVEQLL 27


>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase.  This family
          contains a wide variety of dehydrogenases.
          Length = 167

 Score = 30.6 bits (70), Expect = 0.051
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEI 75
           +V +TGGTG +G  L   L     G +++ L+ R          +AE+
Sbjct: 1  GTVLITGGTGGLGLALARWLAAE--GARHLVLVSRRGPAPGAAELVAEL 47


>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase,
          LLPSF_EDH_00030 family.  This clade within the NAD
          dependent epimerase/dehydratase superfamily (pfam01370)
          is characterized by inclusion of its members within a
          cassette of seven distinctive enzymes. These include
          four genes homologous to the elements of the neuraminic
          (sialic) acid biosynthesis cluster (NeuABCD), an
          aminotransferase and a nucleotidyltransferase in
          addition to the epimerase/dehydratase. Together it is
          very likely that these enzymes direct the biosynthesis
          of a nine-carbon sugar analagous to CMP-neuraminic
          acid. These seven genes form the core of the cassette,
          although they are often accompanied by additional genes
          that may further modify the product sugar. Although
          this cassette is widely distributed in bacteria, the
          family nomenclature arises from the instance in
          Leptospira interrogans serovar Lai, str. 56601, where
          it appears as the 30th gene in the 91-gene
          lipopolysaccharide biosynthesis cluster.
          Length = 297

 Score = 30.3 bits (69), Expect = 0.059
 Identities = 12/20 (60%), Positives = 14/20 (70%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          V VTG  GF+G  LVE L+R
Sbjct: 1  VLVTGADGFIGSHLVEALVR 20


>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e)
          SDRs.  Decarboxylase domain of ArnA. ArnA, is an enzyme
          involved in the modification of outer membrane protein
          lipid A of gram-negative bacteria. It is a bifunctional
          enzyme that catalyzes the NAD-dependent decarboxylation
          of UDP-glucuronic acid and
          N-10-formyltetrahydrofolate-dependent formylation of
          UDP-4-amino-4-deoxy-l-arabinose; its NAD-dependent
          decaboxylating activity is in the C-terminal 360
          residues. This subgroup belongs to the extended SDR
          family, however the NAD binding motif is not a perfect
          match and the upstream Asn of the canonical active site
          tetrad is not conserved. Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 316

 Score = 30.3 bits (69), Expect = 0.067
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRS 49
          +V VTG  GF+G  L E+LLR 
Sbjct: 1  NVLVTGADGFIGSHLTERLLRE 22


>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and
          related proteins, extended (e) SDRs.  UGD catalyzes the
          formation of UDP-xylose from UDP-glucuronate; it is an
          extended-SDR, and has the characteristic glycine-rich
          NAD-binding pattern, TGXXGXXG, and active site tetrad. 
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 305

 Score = 30.3 bits (69), Expect = 0.068
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          + +TGG GF+G  L ++LL 
Sbjct: 3  ILITGGAGFLGSHLCDRLLE 22


>gnl|CDD|224015 COG1090, COG1090, Predicted nucleoside-diphosphate sugar
          epimerase [General function prediction only].
          Length = 297

 Score = 30.3 bits (69), Expect = 0.069
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 11/61 (18%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR--PKHGQDINGR------LAEIINAPL 80
          + +TGGTG +G+ L  +L +   G   + +L R  PK  Q+++        LA+ +   +
Sbjct: 1  ILITGGTGLIGRALTARLRK---GGHQVTILTRRPPKASQNLHPNVTLWEGLADALTLGI 57

Query: 81 D 81
          D
Sbjct: 58 D 58


>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs. 
          GDP-fucose synthetase (aka 3, 5-epimerase-4-reductase)
          acts in the NADP-dependent synthesis of GDP-fucose from
          GDP-mannose. Two activities have been proposed for the
          same active site: epimerization and reduction. Proteins
          in this subgroup are extended SDRs, which have a
          characteristic active site tetrad and an NADP-binding
          motif, [AT]GXXGXXG, that is a close match to the
          archetypical form. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 300

 Score = 29.9 bits (68), Expect = 0.087
 Identities = 8/21 (38%), Positives = 11/21 (52%)

Query: 29 VFVTGGTGFMGKVLVEKLLRS 49
          + VTG  G +G  +V  L R 
Sbjct: 2  ILVTGHRGLVGSAIVRVLARR 22


>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar
          epimerases [Cell envelope biogenesis, outer membrane /
          Carbohydrate transport and metabolism].
          Length = 275

 Score = 29.9 bits (67), Expect = 0.097
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 29 VFVTGGTGFMGKVLVEKLLRS 49
          + VTG TGF+G  +V +LL  
Sbjct: 3  ILVTGATGFVGGAVVRELLAR 23


>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7.  These proteins
          are members of the classical SDR family, with a
          canonical active site triad (and also an active site
          Asn) and a typical Gly-rich NAD-binding motif. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRS are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes have a
          3-glycine N-terminal NAD(P)(H)-binding pattern
          (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
          extended SDRs), while substrate binding is in the
          C-terminal region. A critical catalytic Tyr residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          (15-PGDH) numbering), is often found in a conserved
          YXXXK pattern. In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) or
          additional Ser, contributing to the active site.
          Substrates for these enzymes include sugars, steroids,
          alcohols, and aromatic compounds. The standard reaction
          mechanism is a proton relay involving the conserved Tyr
          and Lys, as well as Asn (or Ser). Some SDR family
          members, including 17 beta-hydroxysteroid dehydrogenase
          contain an additional helix-turn-helix motif that is
          not generally found among SDRs.
          Length = 235

 Score = 29.7 bits (67), Expect = 0.099
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR 61
          ++++V VTG    +GK  VE LL    G K +Y  +R
Sbjct: 2  KDKTVLVTGANRGIGKAFVESLLAH--GAKKVYAAVR 36


>gnl|CDD|187659 cd08956, KR_3_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of
           fatty acid synthase (FAS), subgroup 3, complex (x).
           Ketoreductase, a module of the multidomain polyketide
           synthase (PKS), has 2 subdomains, each corresponding  to
           a SDR family monomer. The C-terminal subdomain catalyzes
           the NADPH-dependent reduction of the beta-carbonyl of a
           polyketide to a hydroxyl group, a step in the
           biosynthesis of polyketides, such as erythromycin. The
           N-terminal subdomain, an interdomain linker, is a
           truncated Rossmann fold which acts to stabilizes the
           catalytic subdomain. Unlike typical SDRs, the isolated
           domain does not oligomerize but is composed of 2
           subdomains, each resembling an SDR monomer. The active
           site resembles that of typical SDRs, except that the
           usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. In some instances, such as
           porcine FAS, an enoyl reductase (ER) module is inserted
           between the sub-domains. Fatty acid synthesis occurs via
           the stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consists of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthesis
           uses a dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles, ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-KR, forming beta-hydroxyacyl-ACP, which is in turn
           dehydrated by dehydratase to a beta-enoyl intermediate,
           which is reduced by NADP-dependent beta- ER. Polyketide
           synthesis also proceeds via the addition of 2-carbon
           units as in fatty acid synthesis. The complex SDR
           NADP-binding motif, GGXGXXG, is often present, but is
           not strictly conserved in each instance of the module.
           This subfamily includes KR domains found in many
           multidomain PKSs, including six of seven Sorangium
           cellulosum PKSs (encoded by spiDEFGHIJ) which
           participate in the synthesis of the polyketide scaffold
           of the cytotoxic spiroketal polyketide spirangien. These
           seven PKSs have either a single PKS module (SpiF), two
           PKR modules (SpiD,-E,-I,-J), or three PKS modules
           (SpiG,-H). This subfamily includes the second KR domains
           of SpiE,-G, I, and -J, both KR domains of SpiD, and the
           third KR domain of SpiH. The single KR domain of SpiF,
           the first and second KR domains of SpiH, the first KR
           domains of SpiE,-G,- I, and -J, and the third KR domain
           of SpiG, belong to a different KR_FAS_SDR subfamily.
           SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 448

 Score = 28.8 bits (65), Expect = 0.27
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 7/50 (14%)

Query: 13  MPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRP 62
           +P P  P      + +V +TGGTG +G +L   L+    G++++ L+ R 
Sbjct: 186 VPRPLDP------DGTVLITGGTGTLGALLARHLVT-EHGVRHLLLVSRR 228


>gnl|CDD|235738 PRK06199, PRK06199, ornithine cyclodeaminase; Validated.
          Length = 379

 Score = 28.5 bits (64), Expect = 0.28
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 10/49 (20%)

Query: 34  GTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW 82
           G G MGK ++   +  CPGI  I           I GR  + +++   W
Sbjct: 162 GPGVMGKTILAAFMAVCPGIDTI----------KIKGRGQKSLDSFATW 200


>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase,
          and related proteins, extended (e) SDRs.  This subgroup
          contains aldehyde reductase and flavonoid reductase of
          the extended SDR-type and related proteins. Proteins in
          this subgroup have a complete SDR-type active site
          tetrad and a close match to the canonical extended SDR
          NADP-binding motif. Aldehyde reductase I (aka carbonyl
          reductase) is an NADP-binding SDR; it catalyzes  the
          NADP-dependent  reduction of ethyl
          4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. The related flavonoid
          reductases act in the NADP-dependent reduction of
          flavonoids, ketone-containing plant secondary
          metabolites. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 295

 Score = 28.7 bits (64), Expect = 0.28
 Identities = 10/19 (52%), Positives = 14/19 (73%)

Query: 29 VFVTGGTGFMGKVLVEKLL 47
          V VTG +GF+   +VE+LL
Sbjct: 1  VLVTGASGFVASHVVEQLL 19


>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
          Provisional.
          Length = 249

 Score = 28.3 bits (64), Expect = 0.30
 Identities = 7/23 (30%), Positives = 11/23 (47%)

Query: 26 NRSVFVTGGTGFMGKVLVEKLLR 48
           R   VTG    +G+ +  +L R
Sbjct: 6  GRVALVTGAARGLGRAIALRLAR 28


>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase.  This
          protein is related to UDP-glucose 4-epimerase (GalE)
          and likewise has an NAD cofactor [Cell envelope,
          Biosynthesis and degradation of surface polysaccharides
          and lipopolysaccharides].
          Length = 317

 Score = 28.1 bits (63), Expect = 0.35
 Identities = 10/24 (41%), Positives = 13/24 (54%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCP 51
           + VTGG GF+G   V  +L   P
Sbjct: 1  RILVTGGAGFIGSNFVRYILNEHP 24


>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e)
          SDRs.  CDP-tyvelose 2-epimerase is a tetrameric SDR
          that catalyzes the conversion of CDP-D-paratose to
          CDP-D-tyvelose, the last step in tyvelose biosynthesis.
          This subgroup is a member of the extended SDR
          subfamily, with a characteristic active site tetrad and
          NAD-binding motif. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 337

 Score = 28.4 bits (64), Expect = 0.36
 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 8/48 (16%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLR---SCPGIKNIYLLMRPKHGQDINGR 71
            V +TGG GF+G  L    L+      G  N   LMR   G   N  
Sbjct: 1  MRVLITGGAGFIGSNLARFFLKQGWEVIGFDN---LMRR--GSFGNLA 43


>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase
          (PCBER) like, atypical (a) SDRs.  PCBER and
          pinoresinol-lariciresinol reductases are
          NADPH-dependent aromatic alcohol reductases, and are
          atypical members of the SDR family. Other proteins in
          this subgroup are identified as eugenol synthase. These
          proteins contain an N-terminus characteristic of
          NAD(P)-binding proteins and a small C-terminal domain
          presumed to be involved in substrate binding, but they
          do not have the conserved active site Tyr residue
          typically found in SDRs. Numerous other members have
          unknown functions. The glycine rich NADP-binding motif
          in this subgroup is of 2 forms: GXGXXG and G[GA]XGXXG;
          it tends to be atypical compared with the forms
          generally seen in classical or extended SDRs. The usual
          SDR active site tetrad is not present, but a critical
          active site Lys at the usual SDR position has been
          identified in various members, though other charged and
          polar residues are found at this position in this
          subgroup. Atypical SDR-related proteins retain the
          Rossmann fold of the SDRs, but have limited sequence
          identity and generally lack the catalytic properties of
          the archetypical members. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 282

 Score = 28.0 bits (63), Expect = 0.38
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPK 63
           + + G TG +G  +V  LL S PG   + +L RP 
Sbjct: 1  KIAIAGATGTLGGPIVSALLAS-PGF-TVTVLTRPS 34


>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase.
          Length = 351

 Score = 28.3 bits (63), Expect = 0.39
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLL 47
          Q  +V VTG +GF+G  LV +LL
Sbjct: 4  QKETVCVTGASGFIGSWLVMRLL 26


>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl
          reductase.
          Length = 390

 Score = 28.2 bits (63), Expect = 0.40
 Identities = 10/21 (47%), Positives = 16/21 (76%)

Query: 28 SVFVTGGTGFMGKVLVEKLLR 48
          +V V G TG++GK +V +L+R
Sbjct: 62 TVLVVGATGYIGKFVVRELVR 82


>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH
          and WbmG-like, extended (e) SDRs.  Bordetella
          bronchiseptica enzymes WbmH and WbmG, and related
          proteins. This subgroup exhibits the active site tetrad
          and NAD-binding motif of the extended SDR family. It
          has been proposed that the active site in Bordetella
          WbmG and WbmH cannot function as an epimerase, and that
          it plays a role in O-antigen synthesis pathway from
          UDP-2,3-diacetamido-2,3-dideoxy-l-galacturonic acid.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 307

 Score = 28.2 bits (63), Expect = 0.42
 Identities = 10/19 (52%), Positives = 13/19 (68%)

Query: 29 VFVTGGTGFMGKVLVEKLL 47
          V +TGG G +G  L+E LL
Sbjct: 3  VLITGGAGQIGSHLIEHLL 21


>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8.  This subgroup
          has a fairly well conserved active site tetrad and
          domain size of the classical SDRs, but has an atypical
          NAD-binding motif ([ST]G[GA]XGXXG). SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRs are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase (15-PGDH)
          numbering). In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) contributing
          to the active site; while substrate binding is in the
          C-terminal region, which determines specificity. The
          standard reaction mechanism is a 4-pro-S hydride
          transfer and proton relay involving the conserved Tyr
          and Lys, a water molecule stabilized by Asn, and
          nicotinamide. Extended SDRs have additional elements in
          the C-terminal region, and typically have a TGXXGXXG
          cofactor binding motif. Complex (multidomain) SDRs such
          as ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
          have lost catalytic activity and/or have an unusual
          NAD(P)-binding motif and missing or unusual active site
          residues. Reactions catalyzed within the SDR family
          include isomerization, decarboxylation, epimerization,
          C=N bond reduction, dehydratase activity,
          dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 250

 Score = 28.1 bits (63), Expect = 0.42
 Identities = 7/23 (30%), Positives = 14/23 (60%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLL 47
          +++ + +TG  G +GK   + LL
Sbjct: 1  EDKIILITGAAGLIGKAFCKALL 23


>gnl|CDD|200381 TIGR04130, FnlA, UDP-N-acetylglucosamine
          4,6-dehydratase/5-epimerase.  The FnlA enzyme is the
          first step in the biosynthesis of UDP-FucNAc from
          UDP-GlcNAc in E. coli (along with FnlB and FnlC). The
          proteins identified by this model include FnlA homologs
          in the O-antigen clusters of O4, O25, O26, O29
          (Shigella D11), O118, O145 and O172 serotype strains,
          all of which produce O-antigens containing FucNAc (or
          the further modified FucNAm). A homolog from
          Pseudomonas aerugiosa serotype O11, WbjB, also involved
          in the biosynthesis of UDP-FucNAc has been
          characterized and is now believed to carry out both the
          initial 4,6-dehydratase reaction and the subsequent
          epimerization of the resulting methyl group at C-5. A
          phylogenetic tree of related sequences shows a distinct
          clade of enzymes involved in the biosynthesis of
          UDP-QuiNAc (Qui=qinovosamine). This clade appears to be
          descendant from the common ancestor of the Pseudomonas
          and E. coli fucose-biosynthesis enzymes. It has been
          hypothesized that the first step in the biosynthesis of
          these two compounds may be the same, and thus that
          these enzymes all have the same function. At present,
          lacking sufficient confirmation of this, the current
          model trusted cutoff only covers the tree segment
          surrounding the E. coli genes. The clades containing
          the Pseudomonas and QuiNAc biosynthesis enzymes score
          above the noise cutoff. Immediately below the noise
          cutoff are enzymes involved in the biosynthesis of
          UDP-RhaNAc (Rha=rhamnose), which again may or may not
          produce the same product.
          Length = 337

 Score = 28.0 bits (62), Expect = 0.44
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 24 YQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQD 67
          ++++ + +TGGTG  G  ++ + L +   IK I +  R +  QD
Sbjct: 2  FKDKILLITGGTGSFGNAVLRRFLDT--DIKEIRIFSRDEKKQD 43


>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase.
          Length = 352

 Score = 28.0 bits (63), Expect = 0.51
 Identities = 10/21 (47%), Positives = 15/21 (71%)

Query: 27 RSVFVTGGTGFMGKVLVEKLL 47
          R++ VTGG G++G   V +LL
Sbjct: 6  RTILVTGGAGYIGSHTVLQLL 26


>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein. 
          This is a family of diverse bacterial polysaccharide
          biosynthesis proteins including the CapD protein, WalL
          protein mannosyl-transferase and several putative
          epimerases (e.g. WbiI).
          Length = 280

 Score = 27.8 bits (63), Expect = 0.52
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR 61
          V VTGG G +G  L  ++L+     K I L  R
Sbjct: 1  VLVTGGGGSIGSELCRQILKF--NPKKIILFSR 31


>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase;
          Reviewed.
          Length = 251

 Score = 27.6 bits (62), Expect = 0.53
 Identities = 6/25 (24%), Positives = 11/25 (44%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLLRS 49
          + R   VTG    +G+ +  +L   
Sbjct: 5  EGRVALVTGAARGIGRAIAVRLAAD 29


>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana
          GDP-mannose-3',5'-epimerase (GME)-like, extended (e)
          SDRs.  This subgroup of NDP-sugar
          epimerase/dehydratases are extended SDRs; they have the
          characteristic active site tetrad, and an NAD-binding
          motif: TGXXGXX[AG], which is a close match to the
          canonical NAD-binding motif. Members include
          Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)
          which catalyzes the epimerization of two positions of
          GDP-alpha-D-mannose to form GDP-beta-L-galactose.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 328

 Score = 27.8 bits (62), Expect = 0.56
 Identities = 9/20 (45%), Positives = 11/20 (55%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
            VTG  GF+G  L E+L  
Sbjct: 3  ALVTGAGGFIGSHLAERLKA 22


>gnl|CDD|218398 pfam05045, RgpF, Rhamnan synthesis protein F.  This family consists
           of a group of proteins which are related to the
           Streptococcus rhamnose-glucose polysaccharide assembly
           protein (RgpF). Rhamnan backbones are found in several O
           polysaccharides of phytopathogenic bacteria and are
           regarded as pathogenic factors.
          Length = 498

 Score = 27.8 bits (62), Expect = 0.57
 Identities = 8/29 (27%), Positives = 15/29 (51%)

Query: 40  KVLVEKLLRSCPGIKNIYLLMRPKHGQDI 68
           K  +E++L    G KN  + +    G+D+
Sbjct: 305 KAEIEEILAKRKGAKNAIVRVVQNRGRDM 333


>gnl|CDD|219957 pfam08659, KR, KR domain.  This enzymatic domain is part of
          bacterial polyketide synthases and catalyzes the first
          step in the reductive modification of the beta-carbonyl
          centres in the growing polyketide chain. It uses NADPH
          to reduce the keto group to a hydroxy group.
          Length = 181

 Score = 27.5 bits (62), Expect = 0.65
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 2/34 (5%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR 61
          +  VTGG G +G  L   L     G +++ LL R
Sbjct: 2  TYLVTGGLGGLGLELARWLAER--GARHLVLLSR 33


>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional.
          Length = 252

 Score = 27.2 bits (61), Expect = 0.70
 Identities = 9/25 (36%), Positives = 11/25 (44%)

Query: 24 YQNRSVFVTGGTGFMGKVLVEKLLR 48
             R V VTGGT  +G  +    L 
Sbjct: 4  LTGRVVLVTGGTRGIGAGIARAFLA 28


>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional.
          Length = 264

 Score = 27.3 bits (61), Expect = 0.76
 Identities = 7/25 (28%), Positives = 10/25 (40%)

Query: 24 YQNRSVFVTGGTGFMGKVLVEKLLR 48
               V VTGG   +G+ + E    
Sbjct: 9  LDGLRVLVTGGASGIGRAIAEAFAE 33


>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase.
          Length = 442

 Score = 27.3 bits (60), Expect = 0.79
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 29  VFVTGGTGFMGKVLVEKLLR 48
           V VTGG GF+G  LV++L+ 
Sbjct: 122 VVVTGGAGFVGSHLVDRLMA 141


>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2.  This subgroup
          contains atypical SDRs, one member is identified as
          Escherichia coli protein ybjT, function unknown.
          Atypical SDRs are distinct from classical SDRs. Members
          of this subgroup have a glycine-rich NAD(P)-binding
          motif consensus that generally matches the extended
          SDRs, TGXXGXXG, but lacks the characteristic active
          site residues of the SDRs. This subgroup has basic
          residues (HXXXR) in place of the active site motif
          YXXXK, these may have a catalytic role. Atypical SDRs
          generally lack the catalytic residues characteristic of
          the SDRs, and their glycine-rich NAD(P)-binding motif
          is often different from the forms normally seen in
          classical or extended SDRs. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 293

 Score = 27.3 bits (61), Expect = 0.81
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 29 VFVTGGTGFMGKVLVEKLLRS 49
          V VTG TG++G  LV +LL+ 
Sbjct: 1  VLVTGATGYVGGRLVPRLLQE 21


>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities
          (related to short-chain alcohol dehydrogenases)
          [Secondary metabolites biosynthesis, transport, and
          catabolism / General function prediction only].
          Length = 251

 Score = 27.1 bits (60), Expect = 0.86
 Identities = 6/24 (25%), Positives = 11/24 (45%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLLR 48
            +   VTG +  +G+ +   L R
Sbjct: 4  SGKVALVTGASSGIGRAIARALAR 27


>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid
          dehydrogenase/isomerase family.  The enzyme 3
          beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase
          (3 beta-HSD) catalyzes the oxidation and isomerisation
          of 5-ene-3 beta-hydroxypregnene and
          5-ene-hydroxyandrostene steroid precursors into the
          corresponding 4-ene-ketosteroids necessary for the
          formation of all classes of steroid hormones.
          Length = 280

 Score = 26.9 bits (60), Expect = 0.90
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 31 VTGGTGFMGKVLVEKLLR 48
          VTGG GF+G+ +V  LLR
Sbjct: 2  VTGGGGFLGRHIVRLLLR 19


>gnl|CDD|187559 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannoheptose 6-epimerase
          (GME), extended (e) SDRs.  This subgroup contains
          ADP-L-glycero-D-mannoheptose 6-epimerase, an extended
          SDR, which catalyzes the NAD-dependent interconversion
          of ADP-D-glycero-D-mannoheptose and
          ADP-L-glycero-D-mannoheptose.  This subgroup has the
          canonical active site tetrad and NAD(P)-binding motif.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 317

 Score = 27.3 bits (61), Expect = 0.90
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLL 59
          + VTGG GF+G  LV+ L     GI +I ++
Sbjct: 2  IIVTGGAGFIGSNLVKALNER--GITDILVV 30


>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          bacterial proteins, and includes the Staphylococcus
          aureus capsular polysaccharide Cap5N, which may have a
          role in the synthesis of UDP-N-acetyl-d-fucosamine.
          This subgroup has the characteristic active site tetrad
          and NAD-binding motif of the extended SDRs. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 303

 Score = 26.9 bits (60), Expect = 0.90
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 28 SVFVTGGTGFMGKVLVEKLL 47
           V VTG  GF+G+ LV+KLL
Sbjct: 1  KVLVTGANGFIGRALVDKLL 20


>gnl|CDD|187553 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8.  This subgroup
          contains atypical SDRs of unknown function. Proteins in
          this subgroup have a glycine-rich NAD(P)-binding motif
          consensus that resembles that of the extended SDRs,
          (GXXGXXG or GGXGXXG), but lacks the characteristic
          active site residues of the SDRs. A Cys often replaces
          the usual Lys of the YXXXK active site motif, while the
          upstream Ser is generally present and Arg replaces the
          usual Asn. Atypical SDRs generally lack the catalytic
          residues characteristic of the SDRs, and their
          glycine-rich NAD(P)-binding motif is often different
          from the forms normally seen in classical or extended
          SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 296

 Score = 27.2 bits (61), Expect = 0.96
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          + +TGGTGF+G+ L  +L  
Sbjct: 2  IVITGGTGFIGRALTRRLTA 21


>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x)
           SDRs.  Ketoreductase, a module of the multidomain
           polyketide synthase (PKS), has 2 subdomains, each
           corresponding  to a SDR family monomer. The C-terminal
           subdomain catalyzes the NADPH-dependent reduction of the
           beta-carbonyl of a polyketide to a hydroxyl group, a
           step in the biosynthesis of polyketides, such as
           erythromycin. The N-terminal subdomain, an interdomain
           linker, is a truncated Rossmann fold which acts to
           stabilizes the catalytic subdomain. Unlike typical SDRs,
           the isolated domain does not oligomerize but is composed
           of 2 subdomains, each resembling an SDR monomer. The
           active site resembles that of typical SDRs, except that
           the usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. Polyketide synthesis also
           proceeds via the addition of 2-carbon units as in fatty
           acid synthesis. The complex SDR NADP-binding motif,
           GGXGXXG, is often present, but is not strictly conserved
           in each instance of the module. This subfamily includes
           both KR domains of the Bacillus subtilis Pks J,-L, and
           PksM, and all three KR domains of PksN, components of
           the megacomplex bacillaene synthase, which synthesizes
           the antibiotic bacillaene. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, human prostaglandin dehydrogenase
           (PGDH) numbering). In addition to the Tyr and Lys, there
           is often an upstream Ser (Ser-138, PGDH numbering)
           and/or an Asn (Asn-107, PGDH numbering) contributing to
           the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type KRs have a TGXXXGX(1-2)G
           NAD(P)-binding motif. Some atypical SDRs have lost
           catalytic activity and/or have an unusual NAD(P)-binding
           motif and missing or unusual active site residues.
           Reactions catalyzed within the SDR family include
           isomerization, decarboxylation, epimerization, C=N bond
           reduction, dehydratase activity, dehalogenation,
           Enoyl-CoA reduction, and carbonyl-alcohol
           oxidoreduction.
          Length = 436

 Score = 26.9 bits (60), Expect = 1.1
 Identities = 11/36 (30%), Positives = 16/36 (44%)

Query: 13  MPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLR 48
           +PA +   +         VTGG G +G+ L   L R
Sbjct: 192 LPAGAAASAPLKPGGVYLVTGGAGGIGRALARALAR 227


>gnl|CDD|218047 pfam04367, DUF502, Protein of unknown function (DUF502).
          Predicted to be an integral membrane protein.
          Length = 108

 Score = 26.3 bits (59), Expect = 1.2
 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 5/34 (14%)

Query: 29 VFVTG--GTGFMGKVLV---EKLLRSCPGIKNIY 57
          +F+ G     F+G+ L+   E+LL   P +++IY
Sbjct: 8  IFLVGLLARNFIGRWLLSLGERLLNRIPLVRSIY 41


>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase.
          Length = 436

 Score = 26.9 bits (59), Expect = 1.2
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 29  VFVTGGTGFMGKVLVEKLL 47
           + VTGG GF+G  LV+KL+
Sbjct: 123 IVVTGGAGFVGSHLVDKLI 141


>gnl|CDD|233775 TIGR02197, heptose_epim,
          ADP-L-glycero-D-manno-heptose-6-epimerase.  This family
          consists of examples of
          ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme
          involved in biosynthesis of the inner core of
          lipopolysaccharide (LPS) for Gram-negative bacteria.
          This enzyme is homologous to UDP-glucose 4-epimerase
          (TIGR01179) and belongs to the NAD dependent
          epimerase/dehydratase family (pfam01370) [Cell
          envelope, Biosynthesis and degradation of surface
          polysaccharides and lipopolysaccharides].
          Length = 314

 Score = 26.9 bits (60), Expect = 1.3
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 14/60 (23%)

Query: 31 VTGGTGFMGKVLVEKLLRSCPGIKNIYLL--MRPKH------GQDINGRLAEIINAPLDW 82
          VTGG GF+G  LV+ L     GI +I ++  +R  H         I    A+ I+     
Sbjct: 3  VTGGAGFIGSNLVKALNER--GITDILVVDNLRDGHKFLNLADLVI----ADYIDKEDFL 56


>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase
          (retinol-DH), Light dependent Protochlorophyllide
          (Pchlide) OxidoReductase (LPOR) and related proteins,
          classical (c) SDRs.  Classical SDR subgroup containing
          retinol-DHs, LPORs, and related proteins. Retinol is
          processed by a medium chain alcohol dehydrogenase
          followed by retinol-DHs. Pchlide reductases act in
          chlorophyll biosynthesis. There are distinct enzymes
          that catalyze Pchlide reduction in light or dark
          conditions. Light-dependent reduction is via an
          NADP-dependent SDR, LPOR. Proteins in this subfamily
          share the glycine-rich NAD-binding motif of the
          classical SDRs, have a partial match to the canonical
          active site tetrad, but lack the typical active site
          Ser. This subgroup includes the human proteins: retinol
          dehydrogenase -12, -13 ,and -14,
          dehydrogenase/reductase SDR family member (DHRS)-12 ,
          -13 and -X (a DHRS on chromosome X), and WWOX (WW
          domain-containing oxidoreductase), as well as a
          Neurospora crassa SDR encoded by the blue light
          inducible bli-4 gene. SDRs are a functionally diverse
          family of oxidoreductases that have a single domain
          with a structurally conserved Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet), an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Classical SDRs are typically about
          250 residues long, while extended SDRs are
          approximately 350 residues. Sequence identity between
          different SDR enzymes are typically in the 15-30%
          range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase (15-PGDH)
          numbering). In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) contributing
          to the active site; while substrate binding is in the
          C-terminal region, which determines specificity. The
          standard reaction mechanism is a 4-pro-S hydride
          transfer and proton relay involving the conserved Tyr
          and Lys, a water molecule stabilized by Asn, and
          nicotinamide. Extended SDRs have additional elements in
          the C-terminal region, and typically have a TGXXGXXG
          cofactor binding motif. Complex (multidomain) SDRs such
          as ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
          have lost catalytic activity and/or have an unusual
          NAD(P)-binding motif and missing or unusual active site
          residues. Reactions catalyzed within the SDR family
          include isomerization, decarboxylation, epimerization,
          C=N bond reduction, dehydratase activity,
          dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 269

 Score = 26.8 bits (60), Expect = 1.3
 Identities = 6/22 (27%), Positives = 11/22 (50%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLR 48
          + V +TG    +GK    +L +
Sbjct: 2  KVVVITGANSGIGKETARELAK 23


>gnl|CDD|181609 PRK09009, PRK09009, C factor cell-cell signaling protein;
          Provisional.
          Length = 235

 Score = 26.6 bits (59), Expect = 1.3
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIK 54
          + + GG+G +GK +V++LL   P   
Sbjct: 3  ILIVGGSGGIGKAMVKQLLERYPDAT 28


>gnl|CDD|182313 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provisional.
          Length = 355

 Score = 26.5 bits (58), Expect = 1.4
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCP 51
          R + +TGG GF+G  LV  ++    
Sbjct: 2  RKILITGGAGFIGSALVRYIINETS 26


>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and
          2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR.
          TTER is a peroxisomal protein with a proposed role in
          fatty acid elongation. Fatty acid synthesis is known to
          occur in the both endoplasmic reticulum and
          mitochondria; peroxisomal TER has been proposed as an
          additional fatty acid elongation system, it reduces the
          double bond at C-2 as the last step of elongation.
          This system resembles the mitochondrial system in that
          acetyl-CoA is used as a carbon donor. TER may also
          function in phytol metabolism, reducting phytenoyl-CoA
          to phytanoyl-CoA in peroxisomes. DECR processes double
          bonds in fatty acids to increase their utility in fatty
          acid metabolism; it reduces 2,4-dienoyl-CoA to an
          enoyl-CoA. DECR is active in mitochondria and
          peroxisomes. This subgroup has the Gly-rich NAD-binding
          motif of the classical SDR family, but does not display
          strong identity to the canonical active site tetrad,
          and lacks the characteristic Tyr at the usual position.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet), an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Classical SDRs are typically about
          250 residues long, while extended SDRS are
          approximately 350 residues. Sequence identity between
          different SDR enzymes are typically in the 15-30%
          range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes have a
          3-glycine N-terminal NAD(P)(H)-binding pattern
          (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
          extended SDRs), while substrate binding is in the
          C-terminal region. A critical catalytic Tyr residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          (15-PGDH) numbering), is often found in a conserved
          YXXXK pattern. In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) or
          additional Ser, contributing to the active site.
          Substrates for these enzymes include sugars, steroids,
          alcohols, and aromatic compounds. The standard reaction
          mechanism is a proton relay involving the conserved Tyr
          and Lys, as well as Asn (or Ser). Some SDR family
          members, including 17 beta-hydroxysteroid dehydrogenase
          contain an additional helix-turn-helix motif that is
          not generally found among SDRs.
          Length = 249

 Score = 26.4 bits (59), Expect = 1.6
 Identities = 6/25 (24%), Positives = 12/25 (48%)

Query: 24 YQNRSVFVTGGTGFMGKVLVEKLLR 48
           + +  F+TGG   +GK + +    
Sbjct: 1  LKGKVAFITGGGTGIGKAIAKAFAE 25


>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial
          polyketide synthases.  It catalyses the first step in
          the reductive modification of the beta-carbonyl centres
          in the growing polyketide chain. It uses NADPH to
          reduce the keto group to a hydroxy group.
          Length = 180

 Score = 26.3 bits (59), Expect = 1.7
 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 2/33 (6%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLL 59
           +  +TGG G +G+ L   L     G + + LL
Sbjct: 1  GTYLITGGLGGLGRALARWLAER--GARRLVLL 31


>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2.  Short-chain
          dehydrogenases/reductases (SDRs, aka Tyrosine-dependent
          oxidoreductases) are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet), an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Classical SDRs are typically about
          250 residues long, while extended SDRs are
          approximately 350 residues. Sequence identity between
          different SDR enzymes are typically in the 15-30%
          range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase (15-PGDH)
          numbering). In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) contributing
          to the active site; while substrate binding is in the
          C-terminal region, which determines specificity. The
          standard reaction mechanism is a 4-pro-S hydride
          transfer and proton relay involving the conserved Tyr
          and Lys, a water molecule stabilized by Asn, and
          nicotinamide. Extended SDRs have additional elements in
          the C-terminal region, and typically have a TGXXGXXG
          cofactor binding motif. Complex (multidomain) SDRs such
          as ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
          have lost catalytic activity and/or have an unusual
          NAD(P)-binding motif and missing or unusual active site
          residues. Reactions catalyzed within the SDR family
          include isomerization, decarboxylation, epimerization,
          C=N bond reduction, dehydratase activity,
          dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 228

 Score = 26.1 bits (58), Expect = 1.9
 Identities = 9/23 (39%), Positives = 12/23 (52%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLL 47
             +V +TGGT  +G  L  K L
Sbjct: 4  TGNTVLITGGTSGIGLALARKFL 26


>gnl|CDD|184952 PRK14990, PRK14990, anaerobic dimethyl sulfoxide reductase subunit
           A; Provisional.
          Length = 814

 Score = 26.1 bits (57), Expect = 1.9
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 14/60 (23%)

Query: 8   TISSNMPAPSTPVSEFYQNRSVFVTGGTGFMG----------KVLVEKLLRSCPGIKNIY 57
            I++NM      + + Y N S+++  GTG +G            LV +L+  C G  N Y
Sbjct: 146 IIATNMQR----LIKEYGNESIYLNYGTGTLGGTMTRSWPPGNTLVARLMNCCGGYLNHY 201


>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding. 
          Length = 182

 Score = 26.1 bits (58), Expect = 2.0
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 31 VTGGTGFMGKVLVEKLLR 48
          V G TG  G+ LV++LL 
Sbjct: 3  VIGATGKTGRRLVKELLA 20


>gnl|CDD|201603 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD
          binding domain.  This Pfam entry contains the following
          members: N-acetyl-glutamine semialdehyde dehydrogenase
          (AgrC) Aspartate-semialdehyde dehydrogenase.
          Length = 121

 Score = 25.6 bits (57), Expect = 2.1
 Identities = 13/57 (22%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPK-HGQ---DINGRLAEIINAPLD 81
          V + G TG++G+ L+ +LL   P ++ + L+   +  G+        L    +  L+
Sbjct: 2  VAIVGATGYVGQELL-RLLAEHPPLELVALVASSRSAGKKVAFAYPILEGGKDLLLE 57


>gnl|CDD|129147 TIGR00036, dapB, dihydrodipicolinate reductase.  [Amino acid
          biosynthesis, Aspartate family].
          Length = 266

 Score = 26.2 bits (58), Expect = 2.1
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 5/55 (9%)

Query: 29 VFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKH---GQDINGRLAEIINAPL 80
          V V G  G MG+ L++  L +  G++ +    R      G D  G LA I    +
Sbjct: 4  VAVAGAAGRMGRELIKAALAA-EGLQLVAAFERHGSSLQGTDA-GELAGIGKVGV 56


>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e)
          SDRs.  GDP-mannose 4,6 dehydratase, a homodimeric SDR,
          catalyzes the NADP(H)-dependent conversion of
          GDP-(D)-mannose to GDP-4-keto, 6-deoxy-(D)-mannose in
          the fucose biosynthesis pathway. These proteins have
          the canonical active site triad and NAD-binding
          pattern, however the active site Asn is often missing
          and may be substituted with Asp. A Glu residue has been
          identified as an important active site base. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 316

 Score = 26.0 bits (58), Expect = 2.2
 Identities = 9/20 (45%), Positives = 10/20 (50%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
            +TG TG  G  L E LL 
Sbjct: 2  ALITGITGQDGSYLAEFLLE 21


>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup
          3, extended (e) SDRs.  Members of this bacterial
          subgroup are identified as possible sugar epimerases,
          such as UDP-glucose 4 epimerase. However, while the
          NAD(P)-binding motif is fairly well conserved, not all
          members retain the canonical active site tetrad of the
          extended SDRs. UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 306

 Score = 26.2 bits (58), Expect = 2.2
 Identities = 8/21 (38%), Positives = 13/21 (61%)

Query: 29 VFVTGGTGFMGKVLVEKLLRS 49
          + VTG  G +G++L  +L  S
Sbjct: 1  ILVTGAAGGLGRLLARRLAAS 21


>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
          Validated.
          Length = 248

 Score = 25.9 bits (58), Expect = 2.2
 Identities = 6/22 (27%), Positives = 13/22 (59%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKL 46
          + +   VTG +  +G+ + E+L
Sbjct: 4  EGKVALVTGASRGIGRAIAERL 25


>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase.
          Length = 353

 Score = 25.9 bits (57), Expect = 2.6
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 31 VTGGTGFMGKVLVEKLLR 48
          VTG TG++G  LV+ LL+
Sbjct: 15 VTGATGYIGSWLVKLLLQ 32


>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 323

 Score = 25.6 bits (57), Expect = 2.9
 Identities = 10/20 (50%), Positives = 13/20 (65%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          V VTGG G++G   V +LL 
Sbjct: 2  VLVTGGAGYIGSHTVVELLE 21


>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c)
          SDR.  This subgroup includes Anabaena sp. strain PCC
          7120 HetN, a putative oxidoreductase involved in
          heterocyst differentiation, and related proteins.  SDRs
          are a functionally diverse family of oxidoreductases
          that have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRs are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase (15-PGDH)
          numbering). In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) contributing
          to the active site; while substrate binding is in the
          C-terminal region, which determines specificity. The
          standard reaction mechanism is a 4-pro-S hydride
          transfer and proton relay involving the conserved Tyr
          and Lys, a water molecule stabilized by Asn, and
          nicotinamide. Extended SDRs have additional elements in
          the C-terminal region, and typically have a TGXXGXXG
          cofactor binding motif. Complex (multidomain) SDRs such
          as ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
          have lost catalytic activity and/or have an unusual
          NAD(P)-binding motif and missing or unusual active site
          residues. Reactions catalyzed within the SDR family
          include isomerization, decarboxylation, epimerization,
          C=N bond reduction, dehydratase activity,
          dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 223

 Score = 25.4 bits (56), Expect = 3.2
 Identities = 8/39 (20%), Positives = 14/39 (35%), Gaps = 3/39 (7%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHG 65
          +   VTG +  +G  +   L R       + L +R    
Sbjct: 1  KVALVTGASRGIGIEIARALARDG---YRVSLGLRNPED 36


>gnl|CDD|178326 PLN02725, PLN02725,
          GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase.
          Length = 306

 Score = 25.4 bits (56), Expect = 3.4
 Identities = 8/17 (47%), Positives = 10/17 (58%)

Query: 30 FVTGGTGFMGKVLVEKL 46
          FV G  G +G  +V KL
Sbjct: 1  FVAGHRGLVGSAIVRKL 17


>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A;
          Provisional.
          Length = 256

 Score = 25.3 bits (56), Expect = 3.5
 Identities = 7/22 (31%), Positives = 14/22 (63%)

Query: 26 NRSVFVTGGTGFMGKVLVEKLL 47
           +++ +TG  G +G  LV+ +L
Sbjct: 4  GKTILITGAGGLIGSALVKAIL 25


>gnl|CDD|221443 pfam12150, MFP2b, Cytosolic motility protein.  This domain family
          is found in eukaryotes, and is approximately 50 amino
          acids in length. These proteins are found in nematodes.
          They complex with MSP (major sperm protein) to allow
          motility. Their action is quite similar to the action
          of bacterial actin molecules.
          Length = 362

 Score = 25.7 bits (56), Expect = 3.5
 Identities = 9/22 (40%), Positives = 15/22 (68%)

Query: 50 CPGIKNIYLLMRPKHGQDINGR 71
            G +N+Y+ +  KHG+ I+GR
Sbjct: 25 ALGQQNMYVALWYKHGKPIHGR 46


>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs.  SDRs are a functionally
          diverse family of oxidoreductases that have a single
          domain with a structurally conserved Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet),
          an NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Classical SDRs are typically about
          250 residues long, while extended SDRs are
          approximately 350 residues. Sequence identity between
          different SDR enzymes are typically in the 15-30%
          range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human prostaglandin
          dehydrogenase (PGDH) numbering). In addition to the Tyr
          and Lys, there is often an upstream Ser (Ser-138, PGDH
          numbering) and/or an Asn (Asn-107, PGDH numbering)
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Extended SDRs have additional
          elements in the C-terminal region, and typically have a
          TGXXGXXG cofactor binding motif. Complex (multidomain)
          SDRs such as ketoreductase domains of fatty acid
          synthase have a GGXGXXG NAD(P)-binding motif and an
          altered active site motif (YXXXN). Fungal type ketoacyl
          reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Some atypical SDRs have lost catalytic activity and/or
          have an unusual NAD(P)-binding motif and missing or
          unusual active site residues. Reactions catalyzed
          within the SDR family include isomerization,
          decarboxylation, epimerization, C=N bond reduction,
          dehydratase activity, dehalogenation, Enoyl-CoA
          reduction, and carbonyl-alcohol oxidoreduction.
          Length = 234

 Score = 25.3 bits (56), Expect = 3.6
 Identities = 6/20 (30%), Positives = 11/20 (55%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
            VTG +  +G+ +  +L R
Sbjct: 1  ALVTGASSGIGRAIARRLAR 20


>gnl|CDD|129255 TIGR00151, ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate
           synthase.  Members of this protein family are
           2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase,
           the IspF protein of the deoxyxylulose (non-mevalonate)
           pathway of IPP biosynthesis. This protein occurs as an
           IspDF bifunctional fusion protein in about 20 percent of
           bacterial genomes [Biosynthesis of cofactors, prosthetic
           groups, and carriers, Other].
          Length = 155

 Score = 25.3 bits (56), Expect = 3.8
 Identities = 9/24 (37%), Positives = 13/24 (54%), Gaps = 3/24 (12%)

Query: 61  RPK---HGQDINGRLAEIINAPLD 81
           RPK   H   +   +AE++  PLD
Sbjct: 101 RPKLLPHIPAMRENIAELLGIPLD 124


>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup
          5, extended (e) SDRs.  This subgroup partially
          conserves the characteristic active site tetrad and
          NAD-binding motif of the extended SDRs, and has been
          identified as possible UDP-glucose 4-epimerase (aka
          UDP-galactose 4-epimerase), a homodimeric member of the
          extended SDR family. UDP-glucose 4-epimerase catalyzes
          the NAD-dependent conversion of UDP-galactose to
          UDP-glucose, the final step in Leloir galactose
          synthesis. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 300

 Score = 25.4 bits (56), Expect = 3.8
 Identities = 10/20 (50%), Positives = 13/20 (65%)

Query: 28 SVFVTGGTGFMGKVLVEKLL 47
           V + GG GF+G  LV+ LL
Sbjct: 1  RVLIVGGNGFIGSHLVDALL 20


>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
          Validated.
          Length = 246

 Score = 25.1 bits (56), Expect = 3.8
 Identities = 6/24 (25%), Positives = 13/24 (54%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLLR 48
          Q ++  VTG +  +G+ +  +L  
Sbjct: 4  QGKTALVTGASRGIGRAIALRLAA 27


>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR).  SDRs
          are a functionally diverse family of oxidoreductases
          that have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRs are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human prostaglandin
          dehydrogenase (PGDH) numbering). In addition to the Tyr
          and Lys, there is often an upstream Ser (Ser-138, PGDH
          numbering) and/or an Asn (Asn-107, PGDH numbering)
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Extended SDRs have additional
          elements in the C-terminal region, and typically have a
          TGXXGXXG cofactor binding motif. Complex (multidomain)
          SDRs such as ketoreductase (KR) domains of fatty acid
          synthase have a GGXGXXG NAD(P)-binding motif and an
          altered active site motif (YXXXN). Fungal type KRs have
          a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical
          SDRs have lost catalytic activity and/or have an
          unusual NAD(P)-binding motif and missing or unusual
          active site residues. Reactions catalyzed within the
          SDR family include isomerization, decarboxylation,
          epimerization, C=N bond reduction, dehydratase
          activity, dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 186

 Score = 25.2 bits (55), Expect = 3.8
 Identities = 8/20 (40%), Positives = 11/20 (55%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          V VTGG+G +G  +   L  
Sbjct: 1  VLVTGGSGGIGGAIARWLAS 20


>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended
          (e) SDRs.  This subgroup contains dTDP-D-glucose
          4,6-dehydratase and related proteins, members of the
          extended-SDR family, with the characteristic Rossmann
          fold core region, active site tetrad and NAD(P)-binding
          motif. dTDP-D-glucose 4,6-dehydratase is closely
          related to other sugar epimerases of the SDR family.
          dTDP-D-dlucose 4,6,-dehydratase catalyzes the second of
          four steps in the dTDP-L-rhamnose pathway (the
          dehydration of dTDP-D-glucose to
          dTDP-4-keto-6-deoxy-D-glucose) in the synthesis of
          L-rhamnose, a cell wall component of some pathogenic
          bacteria. In many gram negative bacteria, L-rhamnose is
          an important constituent of lipopoylsaccharide
          O-antigen. The larger N-terminal portion of
          dTDP-D-Glucose 4,6-dehydratase forms a Rossmann fold
          NAD-binding domain, while the C-terminus binds the
          sugar substrate. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 315

 Score = 25.2 bits (56), Expect = 3.9
 Identities = 14/32 (43%), Positives = 16/32 (50%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYL 58
            + VTGG GF+G   V  LL   P  K I L
Sbjct: 1  MKILVTGGAGFIGSNFVRYLLNKYPDYKIINL 32


>gnl|CDD|215100 PLN00198, PLN00198, anthocyanidin reductase; Provisional.
          Length = 338

 Score = 25.2 bits (55), Expect = 4.6
 Identities = 9/19 (47%), Positives = 14/19 (73%)

Query: 31 VTGGTGFMGKVLVEKLLRS 49
          V GGTGF+  +L++ LL+ 
Sbjct: 14 VIGGTGFLASLLIKLLLQK 32


>gnl|CDD|181080 PRK07680, PRK07680, late competence protein ComER; Validated.
          Length = 273

 Score = 24.9 bits (55), Expect = 4.9
 Identities = 9/16 (56%), Positives = 11/16 (68%)

Query: 34 GTGFMGKVLVEKLLRS 49
          GTG MG +L+E  L S
Sbjct: 7  GTGNMGTILIEAFLES 22


>gnl|CDD|239171 cd02770, MopB_DmsA-EC, This CD (MopB_DmsA-EC) includes the DmsA
           enzyme of the dmsABC operon encoding the anaerobic
           dimethylsulfoxide reductase (DMSOR) of Escherichia coli
           and other related DMSOR-like enzymes. Unlike other
           DMSOR-like enzymes, this group has a  predicted
           N-terminal iron-sulfur [4Fe-4S] cluster  binding site.
           These members belong to the molybdopterin_binding (MopB)
           superfamily of proteins.
          Length = 617

 Score = 25.0 bits (55), Expect = 5.1
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 4/34 (11%)

Query: 8   TISSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKV 41
           TI+S +      + E Y N +++V  GTG  G V
Sbjct: 86  TIASEL----KRIIEKYGNEAIYVNYGTGTYGGV 115


>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope
          biogenesis, outer membrane].
          Length = 340

 Score = 24.9 bits (55), Expect = 5.4
 Identities = 10/30 (33%), Positives = 14/30 (46%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNI 56
            + VTGG GF+G   V  +L   P    +
Sbjct: 1  MKILVTGGAGFIGSNFVRYILNKHPDDHVV 30


>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier
          protein [ACP] reductase (BKR)-like, SDR.  This subgroup
          resembles the SDR family, but does not have a perfect
          match to the NAD-binding motif or the catalytic tetrad
          characteristic of the SDRs. It includes the SDRs,
          Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912
          from Aeropyrum pernix K1. BKR catalyzes the
          NADPH-dependent reduction of ACP in the first reductive
          step of de novo fatty acid synthesis (FAS). FAS
          consists of four elongation steps, which are repeated
          to extend the fatty acid chain through the addition of
          two-carbo units from malonyl acyl-carrier protein
          (ACP): condensation, reduction, dehydration, and a
          final reduction. Type II FAS, typical of plants and
          many bacteria, maintains these activities on discrete
          polypeptides, while type I FAS utilizes one or two
          multifunctional polypeptides. BKR resembles enoyl
          reductase, which catalyzes the second reduction step in
          FAS. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet), an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Classical SDRs are typically about
          250 residues long, while extended SDRS are
          approximately 350 residues. Sequence identity between
          different SDR enzymes are typically in the 15-30%
          range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes have a
          3-glycine N-terminal NAD(P)(H)-binding pattern
          (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
          extended SDRs), while substrate binding is in the
          C-terminal region. A critical catalytic Tyr residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          (15-PGDH) numbering), is often found in a conserved
          YXXXK pattern. In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) or
          additional Ser, contributing to the active site.
          Substrates for these enzymes include sugars, steroids,
          alcohols, and aromatic compounds. The standard reaction
          mechanism is a proton relay involving the conserved Tyr
          and Lys, as well as Asn (or Ser). Some SDR family
          members, including 17 beta-hydroxysteroid dehydrogenase
          contain an additional helix-turn-helix motif that is
          not generally found among SDRs.
          Length = 253

 Score = 24.9 bits (55), Expect = 5.4
 Identities = 5/23 (21%), Positives = 9/23 (39%)

Query: 26 NRSVFVTGGTGFMGKVLVEKLLR 48
           +   VT  +  +G  +   L R
Sbjct: 1  GKVALVTAASSGIGLAIARALAR 23


>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a
          nucleoside-diphosphate-sugar 4-epimerase)-like,
          extended (e) SDRs.  Nucleoside-diphosphate-sugar
          4-epimerase has the characteristic active site tetrad
          and NAD-binding motif of the extended SDR, and is
          related to more specifically defined epimerases such as
          UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), which catalyzes the
          NAD-dependent conversion of UDP-galactose to
          UDP-glucose, the final step in Leloir galactose
          synthesis. This subgroup includes Escherichia coli
          055:H7 Gne, a UDP-GlcNAc 4-epimerase, essential for O55
          antigen synthesis. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 305

 Score = 25.0 bits (55), Expect = 5.5
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCP 51
           V +TG +GF+G+ L E+LL   P
Sbjct: 2  KVLITGASGFVGQRLAERLLSDVP 25


>gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin
           oxidoreductases use flavin as a substrate in mediating
           electron transfer from iron complexes or iron proteins.
           Structurally similar to ferredoxin reductases, but with
           only 15% sequence identity, flavin reductases reduce
           FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a
           substrate, rather than a tightly bound prosthetic group
           as in flavoenzymes; weaker binding is due to the absence
           of a binding site for the AMP moeity of FAD.
          Length = 224

 Score = 24.8 bits (55), Expect = 5.7
 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 5/30 (16%)

Query: 23  FYQNRS----VFVTGGTGFMG-KVLVEKLL 47
           F +  S    + + GGTGF   K ++E LL
Sbjct: 92  FLREDSDRPLILIAGGTGFAPIKSILEHLL 121


>gnl|CDD|215146 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme.
          Length = 668

 Score = 24.7 bits (54), Expect = 6.2
 Identities = 10/35 (28%), Positives = 21/35 (60%)

Query: 24 YQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYL 58
          Y+ +++ +TG  GF+   +  +L+R+ P  K + L
Sbjct: 4  YEPKNILITGAAGFIASHVANRLIRNYPDYKIVVL 38


>gnl|CDD|223928 COG0859, RfaF, ADP-heptose:LPS heptosyltransferase [Cell envelope
          biogenesis, outer membrane].
          Length = 334

 Score = 24.6 bits (54), Expect = 6.3
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 4/37 (10%)

Query: 41 VLVEK----LLRSCPGIKNIYLLMRPKHGQDINGRLA 73
          VLV K    +L+  P I  + ++ + K G  +  RLA
Sbjct: 36 VLVPKGFAPILKLNPEIDKVIIIDKKKKGLGLKERLA 72


>gnl|CDD|182094 PRK09821, PRK09821, putative transporter; Provisional.
          Length = 454

 Score = 24.6 bits (54), Expect = 6.4
 Identities = 10/16 (62%), Positives = 11/16 (68%)

Query: 29  VFVTGGTGFMGKVLVE 44
           + VTG  G  GKVLVE
Sbjct: 318 ILVTGAGGVFGKVLVE 333


>gnl|CDD|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus.
          Dihydrodipicolinate reductase (DapB) reduces the
          alpha,beta-unsaturated cyclic imine,
          dihydro-dipicolinate. This reaction is the second
          committed step in the biosynthesis of L-lysine and its
          precursor meso-diaminopimelate, which are critical for
          both protein and cell wall biosynthesis. The N-terminal
          domain of DapB binds the dinucleotide NADPH.
          Length = 122

 Score = 24.5 bits (54), Expect = 6.5
 Identities = 6/14 (42%), Positives = 10/14 (71%)

Query: 31 VTGGTGFMGKVLVE 44
          V G +G MG+ L++
Sbjct: 5  VVGASGRMGRELIK 18


>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase;
          Provisional.
          Length = 260

 Score = 24.7 bits (54), Expect = 6.6
 Identities = 7/26 (26%), Positives = 17/26 (65%)

Query: 20 VSEFYQNRSVFVTGGTGFMGKVLVEK 45
          +S   + +++ ++GGT  +GK +V +
Sbjct: 2  MSNEMKGKTLVISGGTRGIGKAIVYE 27


>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended
          (e) SDRs.  This subgroup contains UDP-D-glucuronic acid
          4-epimerase, an extended SDR, which catalyzes the
          conversion of UDP-alpha-D-glucuronic acid to
          UDP-alpha-D-galacturonic acid. This group has the SDR's
          canonical catalytic tetrad and the TGxxGxxG NAD-binding
          motif of the extended SDRs. Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 332

 Score = 24.6 bits (54), Expect = 6.9
 Identities = 8/20 (40%), Positives = 13/20 (65%)

Query: 29 VFVTGGTGFMGKVLVEKLLR 48
          + VTG  GF+G  + ++LL 
Sbjct: 3  ILVTGAAGFIGFHVAKRLLE 22


>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase;
          Provisional.
          Length = 266

 Score = 24.6 bits (54), Expect = 6.9
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 25 QNRSVFVTGGTGFMGKVLVEKLL 47
          Q + + VTGG+  +G  +V++LL
Sbjct: 8  QGKIIIVTGGSSGIGLAIVKELL 30


>gnl|CDD|130026 TIGR00951, 2A43, Lysosomal Cystine Transporter.  [Transport and
          binding proteins, Amino acids, peptides and amines].
          Length = 220

 Score = 24.4 bits (53), Expect = 7.3
 Identities = 9/29 (31%), Positives = 11/29 (37%)

Query: 35 TGFMGKVLVEKLLRSCPGIKNIYLLMRPK 63
           GF   V+   L   C  I N + L  P 
Sbjct: 45 VGFTAYVIFNFLQLYCWSITNEFPLSSPG 73


>gnl|CDD|237079 PRK12367, PRK12367, short chain dehydrogenase; Provisional.
          Length = 245

 Score = 24.6 bits (54), Expect = 7.7
 Identities = 9/34 (26%), Positives = 16/34 (47%)

Query: 13 MPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKL 46
          MP         +Q + + +TG +G +GK L +  
Sbjct: 1  MPQADPMAQSTWQGKRIGITGASGALGKALTKAF 34


>gnl|CDD|187652 cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like
          proteins (5beta-POR), atypical (a) SDRs.  5beta-POR
          catalyzes the reduction of progesterone to
          5beta-pregnane-3,20-dione in Digitalis plants. This
          subgroup of atypical-extended SDRs, shares the
          structure of an extended SDR, but has a different
          glycine-rich nucleotide binding motif  (GXXGXXG) and
          lacks the YXXXK active site motif of classical and
          extended SDRs. Tyr-179 and Lys 147 are present in the
          active site, but not in the usual SDR configuration.
          Given these differences, it has been proposed that this
          subfamily represents a new SDR class. Other atypical
          SDRs include biliverdin IX beta reductase (BVR-B,aka
          flavin reductase), NMRa (a negative transcriptional
          regulator of various fungi), phenylcoumaran benzylic
          ether and pinoresinol-lariciresinol reductases,
          phenylpropene synthases, eugenol synthase,
          triphenylmethane reductase, isoflavone reductases, and
          others. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. In
          addition to the Rossmann fold core region typical of
          all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids,
          and typically have a TGXXGXXG cofactor binding motif.
          Complex (multidomain) SDRs such as ketoreductase
          domains of fatty acid synthase have a GGXGXXG
          NAD(P)-binding motif and an altered active site motif
          (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 308

 Score = 24.5 bits (54), Expect = 8.2
 Identities = 13/34 (38%), Positives = 14/34 (41%)

Query: 28 SVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMR 61
             V G TG  G  LVE LL        +Y L R
Sbjct: 1  VALVVGATGISGWALVEHLLSDPGTWWKVYGLSR 34


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0845    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,271,498
Number of extensions: 336268
Number of successful extensions: 536
Number of sequences better than 10.0: 1
Number of HSP's gapped: 534
Number of HSP's successfully gapped: 122
Length of query: 82
Length of database: 10,937,602
Length adjustment: 51
Effective length of query: 31
Effective length of database: 8,675,548
Effective search space: 268941988
Effective search space used: 268941988
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.0 bits)