Query         psy16531
Match_columns 104
No_of_seqs    126 out of 1017
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 23:40:15 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16531.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16531hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0161|consensus               99.6 5.1E-16 1.1E-20  141.4   6.5   84   14-98    743-843 (1930)
  2 COG5022 Myosin heavy chain [Cy  99.5 2.2E-14 4.8E-19  127.5   6.4   83   14-97    715-814 (1463)
  3 KOG0164|consensus               99.3 2.1E-12 4.5E-17  109.8   5.4   68   15-86    666-737 (1001)
  4 PTZ00014 myosin-A; Provisional  99.3 5.3E-12 1.1E-16  109.1   7.4   62   14-79    744-808 (821)
  5 KOG0162|consensus               99.3   9E-12   2E-16  106.3   6.7   56   14-70    665-721 (1106)
  6 KOG0160|consensus               98.7   2E-08 4.3E-13   87.2   6.7   59   17-79    646-704 (862)
  7 PF00612 IQ:  IQ calmodulin-bin  97.9 1.7E-05 3.7E-10   38.8   3.5   20   46-65      2-21  (21)
  8 KOG0163|consensus               97.9 9.6E-06 2.1E-10   70.5   4.1   59    8-68    739-836 (1259)
  9 cd01384 MYSc_type_XI Myosin mo  97.6 3.6E-05 7.8E-10   65.9   2.7   29   15-44    646-674 (674)
 10 smart00015 IQ Short calmodulin  97.5 0.00014   3E-09   37.1   2.9   22   44-65      2-23  (26)
 11 cd01378 MYSc_type_I Myosin mot  97.4 7.1E-05 1.5E-09   64.0   1.4   26   14-40    648-674 (674)
 12 cd01383 MYSc_type_VIII Myosin   97.4 7.4E-05 1.6E-09   64.0   1.3   29   10-40    649-677 (677)
 13 cd01386 MYSc_type_XVIII Myosin  97.3 7.3E-05 1.6E-09   64.9   1.1   26   14-40    742-767 (767)
 14 cd01377 MYSc_type_II Myosin mo  97.2 0.00012 2.6E-09   62.8   1.4   25   15-40    669-693 (693)
 15 smart00242 MYSc Myosin. Large   97.2 0.00015 3.2E-09   62.0   1.7   27   14-41    651-677 (677)
 16 cd01382 MYSc_type_VI Myosin mo  97.2 0.00019   4E-09   61.9   2.3   25   14-39    691-715 (717)
 17 cd01380 MYSc_type_V Myosin mot  97.2 0.00016 3.5E-09   62.0   1.7   26   14-40    666-691 (691)
 18 cd01387 MYSc_type_XV Myosin mo  97.1 0.00018   4E-09   61.6   1.4   30    9-40    648-677 (677)
 19 cd01381 MYSc_type_VII Myosin m  97.1 0.00022 4.7E-09   61.1   1.7   26   14-40    646-671 (671)
 20 cd00124 MYSc Myosin motor doma  97.0 0.00032 6.9E-09   60.0   1.3   26   14-40    654-679 (679)
 21 cd01379 MYSc_type_III Myosin m  96.7 0.00065 1.4E-08   58.1   1.5   25   15-40    629-653 (653)
 22 cd01385 MYSc_type_IX Myosin mo  96.3  0.0026 5.6E-08   54.8   2.5   31   10-42    660-690 (692)
 23 KOG0160|consensus               84.2     1.2 2.6E-05   39.8   3.5   19   44-62    695-713 (862)
 24 KOG4427|consensus               81.0     3.1 6.7E-05   37.2   4.8   25   43-67     28-52  (1096)
 25 KOG0377|consensus               74.7     6.9 0.00015   33.2   4.9   40   36-79      8-47  (631)
 26 KOG0942|consensus               73.8     5.9 0.00013   35.8   4.5   37   43-79     27-64  (1001)
 27 PF15157 IQ-like:  IQ-like       61.2      10 0.00022   25.2   2.7   22   44-65     46-67  (97)
 28 PTZ00014 myosin-A; Provisional  42.4      43 0.00094   30.0   4.4   22   42-63    797-818 (821)
 29 PF05924 SAMP:  SAMP Motif;  In  28.4      20 0.00043   17.3   0.0   11   92-102     2-12  (20)
 30 PF11430 EGL-1:  Programmed cel  24.9      15 0.00031   18.0  -0.8   11   93-103     5-15  (21)
 31 KOG0165|consensus               24.1 1.3E+02  0.0028   27.4   4.2   24   45-68    943-966 (1023)
 32 KOG1419|consensus               22.7      95  0.0021   27.1   3.1   26   36-61    327-356 (654)
 33 PF08763 Ca_chan_IQ:  Voltage g  20.6 1.6E+02  0.0036   16.0   2.8   17   47-63     11-27  (35)

No 1  
>KOG0161|consensus
Probab=99.62  E-value=5.1e-16  Score=141.41  Aligned_cols=84  Identities=37%  Similarity=0.612  Sum_probs=79.7

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc--------------
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQSQSDLLNPR--------------   79 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R~~~l~~~a~~iQ~~~RG~l~Rr~y~~~r~~~~A~~~IQ~--------------   79 (104)
                      +...|++| .||||||+|+++.||++|+..++.+++.+|+.||||++|+.|.+...+..|+.+||+              
T Consensus       743 d~~lyriG-~tKvFfkaGvla~LEe~Rd~~ls~ii~~fQA~~Rg~l~r~~~~kr~~~~~ai~~iQ~N~r~~~~lr~w~W~  821 (1930)
T KOG0161|consen  743 DKNLYRIG-HTKVFFKAGVLAHLEEMRDEKLSQIITLFQAAIRGYLARKEFKKRLQQLDAIKVIQRNIRAYLKLRTWPWW  821 (1930)
T ss_pred             ccceEeec-ceeeeehHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCHHH
Confidence            34569999 999999999999999999999999999999999999999999999999999999999              


Q ss_pred             ---ccccccccCccchhhhhhc
Q psy16531         80 ---VELKPSFNVTKDTLPIAIS   98 (104)
Q Consensus        80 ---~~ikplL~~~~~~~~~~~~   98 (104)
                         .+|||||.+++++++++..
T Consensus       822 ~Lf~kvkPLL~~~~~ee~~~~~  843 (1930)
T KOG0161|consen  822 RLFTKVKPLLKVTKTEEEMRAK  843 (1930)
T ss_pred             HHHHHHHHHHHhhhhHHHHHHh
Confidence               8999999999999998763


No 2  
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=99.51  E-value=2.2e-14  Score=127.54  Aligned_cols=83  Identities=24%  Similarity=0.417  Sum_probs=75.3

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc--------------
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQSQSDLLNPR--------------   79 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R~~~l~~~a~~iQ~~~RG~l~Rr~y~~~r~~~~A~~~IQ~--------------   79 (104)
                      |+..||+| +||||||+|+++.||++|+..++.+++.||++|||++.|++|........++..+|.              
T Consensus       715 d~~~YqiG-~TKvFfKagvL~~LE~~Rd~~~~~~~~~iq~aiR~~~~rrr~~~~~k~i~~~~~~~~~~~~~~~~~~~~~~  793 (1463)
T COG5022         715 DSSKYQIG-NTKVFFKAGVLAALEDMRDAKLDNIATRIQRAIRGRYLRRRYLQALKRIKKIQVIQHGFRLRRLVDYELKW  793 (1463)
T ss_pred             Chhheecc-ceeEEeeCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhcccchHH
Confidence            45789999 999999999999999999999999999999999999999999998877777777777              


Q ss_pred             ---ccccccccCccchhhhhh
Q psy16531         80 ---VELKPSFNVTKDTLPIAI   97 (104)
Q Consensus        80 ---~~ikplL~~~~~~~~~~~   97 (104)
                         .+++|++......++.+.
T Consensus       794 ~~~~~l~~~~~~~~~r~~~~~  814 (1463)
T COG5022         794 RLFIKLQPLLSLLGSRKEYRS  814 (1463)
T ss_pred             HhHHHhhHHhHHHhhHHHHHH
Confidence               788999999988887765


No 3  
>KOG0164|consensus
Probab=99.31  E-value=2.1e-12  Score=109.85  Aligned_cols=68  Identities=28%  Similarity=0.456  Sum_probs=58.8

Q ss_pred             CCCceecCcCeeecc-cccHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc---ccccccc
Q psy16531         15 PDWSLLGRYPQVFFR-AGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQSQSDLLNPR---VELKPSF   86 (104)
Q Consensus        15 ~~~y~iGg~TKVF~r-~g~l~~LE~~R~~~l~~~a~~iQ~~~RG~l~Rr~y~~~r~~~~A~~~IQ~---~~ikplL   86 (104)
                      .+++.+| +||||+| +.+++.||+.|.+++..+++.||++||||++|.+|+++++   +..+|++   +|+|.++
T Consensus       666 ~~d~a~G-~TKIFIRsPrTLF~lEe~r~~~l~~lvtllQK~~RG~~~R~ry~rmka---~~~ii~wyR~~K~ks~v  737 (1001)
T KOG0164|consen  666 AGDVAFG-RTKIFIRSPRTLFALEEQRAERLPSLVTLLQKAWRGWLARQRYRRMKA---SATIIRWYRRYKLKSYV  737 (1001)
T ss_pred             chhhhcC-ceeEEEecchhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH
Confidence            3679999 9999999 5699999999999999999999999999999999999975   5556666   5555444


No 4  
>PTZ00014 myosin-A; Provisional
Probab=99.30  E-value=5.3e-12  Score=109.06  Aligned_cols=62  Identities=15%  Similarity=0.282  Sum_probs=55.8

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHHHHHhh---hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELRDDRLG---KIVGWMQSYMRGYLSRKEYKKIQEQSQSDLLNPR   79 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R~~~l~---~~a~~iQ~~~RG~l~Rr~y~~~r~~~~A~~~IQ~   79 (104)
                      ++++|++| +||||||+|++..||+.|++++.   .+++.||++||||++|++|.+++   .|+++||+
T Consensus       744 ~~~~~~iG-kTKVFlr~~~~~~Le~~~~~~~~~~~~~~~~iq~~~r~~~~r~~~~~~~---~~~~~iQ~  808 (821)
T PTZ00014        744 PKDSYAIG-KTMVFLKKDAAKELTQIQREKLAAWEPLVSVLEALILKIKKKRKVRKNI---KSLVRIQA  808 (821)
T ss_pred             CcccEEec-CCeEEEcCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHH
Confidence            35789999 99999999999999998888765   58899999999999999999974   48899999


No 5  
>KOG0162|consensus
Probab=99.26  E-value=9e-12  Score=106.30  Aligned_cols=56  Identities=27%  Similarity=0.542  Sum_probs=52.7

Q ss_pred             CCCCceecCcCeeecc-cccHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFR-AGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQ   70 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r-~g~l~~LE~~R~~~l~~~a~~iQ~~~RG~l~Rr~y~~~r~~   70 (104)
                      ++++||+| .||||+| +..|+.||++|++....+|..||++||.|++|++|.++|.+
T Consensus       665 ~~~qyQmG-~tkVFiKnPEsLF~LEemRer~~d~~A~~IQkAWRrfv~rrky~k~ree  721 (1106)
T KOG0162|consen  665 PSDQYQMG-VTKVFIKNPESLFLLEEMRERKWDGMARRIQKAWRRFVARRKYEKMREE  721 (1106)
T ss_pred             ChhHhhcc-ceeEEecChHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            46899999 9999999 56999999999999999999999999999999999999864


No 6  
>KOG0160|consensus
Probab=98.74  E-value=2e-08  Score=87.25  Aligned_cols=59  Identities=27%  Similarity=0.502  Sum_probs=55.8

Q ss_pred             CceecCcCeeecccccHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc
Q psy16531         17 WSLLGRYPQVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQSQSDLLNPR   79 (104)
Q Consensus        17 ~y~iGg~TKVF~r~g~l~~LE~~R~~~l~~~a~~iQ~~~RG~l~Rr~y~~~r~~~~A~~~IQ~   79 (104)
                      .||+| +||||||+|....||..|...+...++.||+.+|||+.|+.|..+|.   ++..||.
T Consensus       646 ~yq~g-~tkif~r~gq~~~le~~R~~vl~~~~~~iq~~~r~~~~r~~f~~~r~---~~~~~Q~  704 (862)
T KOG0160|consen  646 LYQIG-KTKIFLRAGQIAVLEARRSDVLSAAKVLIQRQIRGYLARKKFLQLRS---AVIIIQA  704 (862)
T ss_pred             ceeee-eeeeeeccchhHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHH---HHHHHhh
Confidence            89999 99999999999999999999999999999999999999999999754   7888888


No 7  
>PF00612 IQ:  IQ calmodulin-binding motif;  InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K. The IQ motif, which can be present in one or more copies, serves as a binding site for different EF-hand proteins including the essential and regulatory myosin light chains, calmodulin (CaM), and CaM-like proteins [, ].Many IQ motifs are protein kinase C (PKC) phosphorylation sites [, ]. Resolution of the 3D structure of scallop myosin has shown that the IQ motif forms a basic amphipathic helix []. Some proteins known to contain an IQ motif are listed below:  A number of conventional and unconventional myosins. Neuromodulin (GAP-43). This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Neurogranin (NG/p17). Acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Sperm surface protein Sp17. Ras GTPase-activating-like protein IQGAP1. IQGAP1 contains 4 IQ motifs.   This entry covers the entire IQ motif.; GO: 0005515 protein binding; PDB: 2DFS_A 2IX7_C 1OE9_A 1W7J_A 1W7I_A 1KQM_A 1KK7_A 1WDC_A 1DFL_A 1B7T_A ....
Probab=97.94  E-value=1.7e-05  Score=38.75  Aligned_cols=20  Identities=60%  Similarity=0.898  Sum_probs=18.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q psy16531         46 KIVGWMQSYMRGYLSRKEYK   65 (104)
Q Consensus        46 ~~a~~iQ~~~RG~l~Rr~y~   65 (104)
                      .+++.||+.||||++|+.|+
T Consensus         2 ~aai~iQ~~~R~~~~Rk~~k   21 (21)
T PF00612_consen    2 KAAIIIQSYWRGYLARKRYK   21 (21)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhcC
Confidence            57899999999999999884


No 8  
>KOG0163|consensus
Probab=97.93  E-value=9.6e-06  Score=70.47  Aligned_cols=59  Identities=27%  Similarity=0.388  Sum_probs=42.9

Q ss_pred             ccCCCCCCCCceecCcCeeecccccHHHHHHHHHHHhh---------------------------------------hHH
Q psy16531          8 HFLGEPPPDWSLLGRYPQVFFRAGVLGQMEELRDDRLG---------------------------------------KIV   48 (104)
Q Consensus         8 ~~~~~~~~~~y~iGg~TKVF~r~g~l~~LE~~R~~~l~---------------------------------------~~a   48 (104)
                      +.|+++. .+|++| .||||||+|-.+...++-...-.                                       ..+
T Consensus       739 ~aLgL~q-~DfkFG-lTKVFFr~GKFaEFDqiMksDPe~m~~lv~kVn~WLv~sRWkk~q~~a~sVIKLkNkI~yRae~v  816 (1259)
T KOG0163|consen  739 QALGLDQ-NDFKFG-LTKVFFRPGKFAEFDQIMKSDPETMLELVAKVNKWLVRSRWKKSQYGALSVIKLKNKIIYRAECV  816 (1259)
T ss_pred             HHhCCCc-cccccc-ceeEeecCcchHHHHHHHhcCHHHHHHHHHHHHHHHHHhHHHHhhhhhhheeehhhHHHHHHHHH
Confidence            4566554 579999 99999999988766653322111                                       114


Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy16531         49 GWMQSYMRGYLSRKEYKKIQ   68 (104)
Q Consensus        49 ~~iQ~~~RG~l~Rr~y~~~r   68 (104)
                      +.+|+++|||++|+++....
T Consensus       817 ~k~Q~~~Rg~L~rkr~~~ri  836 (1259)
T KOG0163|consen  817 LKAQRIARGYLARKRHRPRI  836 (1259)
T ss_pred             HHHHHHHHHHHHHhhhchHH
Confidence            88999999999999988753


No 9  
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=97.62  E-value=3.6e-05  Score=65.87  Aligned_cols=29  Identities=28%  Similarity=0.482  Sum_probs=26.3

Q ss_pred             CCCceecCcCeeecccccHHHHHHHHHHHh
Q psy16531         15 PDWSLLGRYPQVFFRAGVLGQMEELRDDRL   44 (104)
Q Consensus        15 ~~~y~iGg~TKVF~r~g~l~~LE~~R~~~l   44 (104)
                      .++|++| +||||||+|+++.||+.|++.+
T Consensus       646 ~~~~~~G-ktkVFlr~~~~~~LE~~R~~~~  674 (674)
T cd01384         646 LKGYQIG-KTKVFLRAGQMAELDARRTEVL  674 (674)
T ss_pred             CCCEEec-CeeEEEcCCHHHHHHHHHHhcC
Confidence            4679999 9999999999999999999754


No 10 
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues. Calmodulin-binding motif.
Probab=97.49  E-value=0.00014  Score=37.15  Aligned_cols=22  Identities=45%  Similarity=0.685  Sum_probs=19.3

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHH
Q psy16531         44 LGKIVGWMQSYMRGYLSRKEYK   65 (104)
Q Consensus        44 l~~~a~~iQ~~~RG~l~Rr~y~   65 (104)
                      ...+++.||+.||||++|+.|.
T Consensus         2 ~~~aa~~IQa~~Rg~~~r~~y~   23 (26)
T smart00015        2 LTRAAIIIQAAWRGYLARKRYK   23 (26)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhh
Confidence            3568899999999999999984


No 11 
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=97.36  E-value=7.1e-05  Score=64.03  Aligned_cols=26  Identities=31%  Similarity=0.523  Sum_probs=23.2

Q ss_pred             CCCCceecCcCeeecccc-cHHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFRAG-VLGQMEELR   40 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g-~l~~LE~~R   40 (104)
                      ++++|++| +||||||+| +++.||++|
T Consensus       648 ~~~~~~~G-kTkVFlr~~~~l~~le~~R  674 (674)
T cd01378         648 DPEEYQMG-KTKIFIRNPETLFALEEMR  674 (674)
T ss_pred             CcccEEec-CceEEEeCchhHHHHHhcC
Confidence            45789999 999999997 899999876


No 12 
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=97.35  E-value=7.4e-05  Score=64.02  Aligned_cols=29  Identities=34%  Similarity=0.792  Sum_probs=24.9

Q ss_pred             CCCCCCCCceecCcCeeecccccHHHHHHHH
Q psy16531         10 LGEPPPDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus        10 ~~~~~~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      ++++ +++|++| +||||||+|+++.||+.|
T Consensus       649 ~~~~-~~~~~~G-kTKVFlr~~~~~~LE~~r  677 (677)
T cd01383         649 FNIL-PEMYQVG-YTKLFFRTGQIGALEDTR  677 (677)
T ss_pred             cCCC-cccEEec-cceEEecCcHHHHHhhcC
Confidence            4444 5789999 999999999999999876


No 13 
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=97.34  E-value=7.3e-05  Score=64.89  Aligned_cols=26  Identities=46%  Similarity=0.667  Sum_probs=23.6

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      ++++|+|| +||||||+++++.||+.|
T Consensus       742 ~~~~~~iG-kTKVFlr~~~~~~LE~~R  767 (767)
T cd01386         742 DKSSYRIG-HSQVFFRAGVLSRLEAQR  767 (767)
T ss_pred             CcceEEee-cceEEecccHHHHHhccC
Confidence            35789999 999999999999999876


No 14 
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=97.24  E-value=0.00012  Score=62.84  Aligned_cols=25  Identities=52%  Similarity=0.922  Sum_probs=23.1

Q ss_pred             CCCceecCcCeeecccccHHHHHHHH
Q psy16531         15 PDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus        15 ~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      +++|++| +||||||++++..||+.|
T Consensus       669 ~~~~~~G-~TKVFlk~~~~~~LE~~R  693 (693)
T cd01377         669 PEQYRFG-HTKVFFRAGVLAHLEEMR  693 (693)
T ss_pred             cccEEec-CCeEeECccHHHHHhhcC
Confidence            5789999 999999999999999876


No 15 
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=97.22  E-value=0.00015  Score=62.04  Aligned_cols=27  Identities=44%  Similarity=0.690  Sum_probs=24.6

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELRD   41 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R~   41 (104)
                      ++++|++| +||||||+++++.||+.|+
T Consensus       651 ~~~~~~iG-kTkVFlk~~~~~~Le~~R~  677 (677)
T smart00242      651 DEDEYQLG-KTKVFLRPGQLAELEELRE  677 (677)
T ss_pred             CcccEEec-CceEeECccHHHHHHhhcC
Confidence            35789999 9999999999999999885


No 16 
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=97.21  E-value=0.00019  Score=61.93  Aligned_cols=25  Identities=24%  Similarity=0.562  Sum_probs=22.5

Q ss_pred             CCCCceecCcCeeecccccHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEEL   39 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~   39 (104)
                      ++++|++| +||||||+|+++.||..
T Consensus       691 ~~~~~~~G-kTKVFlr~g~~~~le~~  715 (717)
T cd01382         691 NENDYKFG-LTKVFFRPGKFAEFDQI  715 (717)
T ss_pred             CcccEEec-ceeEEecccHHHHHHHH
Confidence            35789999 99999999999999975


No 17 
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=97.19  E-value=0.00016  Score=62.02  Aligned_cols=26  Identities=38%  Similarity=0.640  Sum_probs=23.7

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      ++++|++| +||||||++++..||+.|
T Consensus       666 ~~~~~~~G-~tkVFlk~~~~~~LE~~R  691 (691)
T cd01380         666 DEDKYQFG-KTKIFFRAGQVAFLEKLR  691 (691)
T ss_pred             CcccEEec-CceEEECcCHHHHHhhcC
Confidence            46789999 999999999999999876


No 18 
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=97.13  E-value=0.00018  Score=61.61  Aligned_cols=30  Identities=20%  Similarity=0.424  Sum_probs=25.2

Q ss_pred             cCCCCCCCCceecCcCeeecccccHHHHHHHH
Q psy16531          9 FLGEPPPDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus         9 ~~~~~~~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      .++++ +++|++| +||||||++++..||.+|
T Consensus       648 ~~~~~-~~~~~iG-~TkVFlk~~~~~~LE~~r  677 (677)
T cd01387         648 LCGVE-PPMYRVG-ASKLFLKEHLHQLLESMR  677 (677)
T ss_pred             HcCCC-cccEEec-ceeEEEcCCHHHHHHhcC
Confidence            34444 5689999 999999999999999876


No 19 
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=97.11  E-value=0.00022  Score=61.10  Aligned_cols=26  Identities=27%  Similarity=0.203  Sum_probs=23.6

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      ++++|++| +||||||++++..||+.|
T Consensus       646 ~~~~~~~G-~TkVFlr~~~~~~LE~~r  671 (671)
T cd01381         646 ADDDWQLG-KTKVFLKDHHDLLLEQER  671 (671)
T ss_pred             CcccEEec-cceEEECcCHHHHHhhcC
Confidence            46789999 999999999999999876


No 20 
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=96.96  E-value=0.00032  Score=59.98  Aligned_cols=26  Identities=35%  Similarity=0.664  Sum_probs=23.3

Q ss_pred             CCCCceecCcCeeecccccHHHHHHHH
Q psy16531         14 PPDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus        14 ~~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      ++++|++| +||||||++++..||+.|
T Consensus       654 ~~~~~~vG-kTkVFlr~~~~~~LE~~r  679 (679)
T cd00124         654 PKDEWQVG-KTKVFLKEGQLSELEKMR  679 (679)
T ss_pred             CccCEEec-CCeEEECcCHHHHHhccC
Confidence            35789999 999999999999999865


No 21 
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=96.74  E-value=0.00065  Score=58.12  Aligned_cols=25  Identities=28%  Similarity=0.313  Sum_probs=22.5

Q ss_pred             CCCceecCcCeeecccccHHHHHHHH
Q psy16531         15 PDWSLLGRYPQVFFRAGVLGQMEELR   40 (104)
Q Consensus        15 ~~~y~iGg~TKVF~r~g~l~~LE~~R   40 (104)
                      .++|++| +||||||++.++.||.+|
T Consensus       629 ~~~~~~G-ktkvFlk~~~~~~le~~~  653 (653)
T cd01379         629 LDNWALG-KTKVFLKYYHVEQLNLMR  653 (653)
T ss_pred             CCCEEec-ceEEEEecCHHHHHHhcC
Confidence            3579999 999999999999999865


No 22 
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=96.31  E-value=0.0026  Score=54.78  Aligned_cols=31  Identities=13%  Similarity=0.163  Sum_probs=25.1

Q ss_pred             CCCCCCCCceecCcCeeecccccHHHHHHHHHH
Q psy16531         10 LGEPPPDWSLLGRYPQVFFRAGVLGQMEELRDD   42 (104)
Q Consensus        10 ~~~~~~~~y~iGg~TKVF~r~g~l~~LE~~R~~   42 (104)
                      ++++ +++|++| +||||||++....||+.-.+
T Consensus       660 ~~~~-~~~~~iG-kTkVFlr~~~~~~Le~~~~~  690 (692)
T cd01385         660 MKID-KRNYQIG-KTKIFMRETEKQALDETLHR  690 (692)
T ss_pred             cCCC-cccEEee-CceEEEcccHHHHHHHHHhh
Confidence            3443 5689999 99999999999999986543


No 23 
>KOG0160|consensus
Probab=84.19  E-value=1.2  Score=39.82  Aligned_cols=19  Identities=42%  Similarity=0.611  Sum_probs=9.9

Q ss_pred             hhhHHHHHHHHHHHHHHHH
Q psy16531         44 LGKIVGWMQSYMRGYLSRK   62 (104)
Q Consensus        44 l~~~a~~iQ~~~RG~l~Rr   62 (104)
                      ....++.||+.+||+++|+
T Consensus       695 ~r~~~~~~Q~~~rG~~~r~  713 (862)
T KOG0160|consen  695 LRSAVIIIQAYSRGVLARR  713 (862)
T ss_pred             HHHHHHHHhhhhhHHHHHH
Confidence            3344555555555555555


No 24 
>KOG4427|consensus
Probab=80.95  E-value=3.1  Score=37.24  Aligned_cols=25  Identities=28%  Similarity=0.348  Sum_probs=21.5

Q ss_pred             HhhhHHHHHHHHHHHHHHHHHHHHH
Q psy16531         43 RLGKIVGWMQSYMRGYLSRKEYKKI   67 (104)
Q Consensus        43 ~l~~~a~~iQ~~~RG~l~Rr~y~~~   67 (104)
                      +-..+|..||+.||||+.|++|+..
T Consensus        28 rr~~aa~~iq~~lrsyl~Rkk~~~~   52 (1096)
T KOG4427|consen   28 RREAAALFIQRVLRSYLVRKKAQIE   52 (1096)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4456789999999999999999864


No 25 
>KOG0377|consensus
Probab=74.66  E-value=6.9  Score=33.18  Aligned_cols=40  Identities=20%  Similarity=0.147  Sum_probs=29.5

Q ss_pred             HHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc
Q psy16531         36 MEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQSQSDLLNPR   79 (104)
Q Consensus        36 LE~~R~~~l~~~a~~iQ~~~RG~l~Rr~y~~~r~~~~A~~~IQ~   79 (104)
                      -|-.+..+--.+|+.||+|.|+|.+|...++    +.+-.+.|.
T Consensus         8 t~~~~s~raikaAilIQkWYRr~~ARle~rr----r~twqIFqs   47 (631)
T KOG0377|consen    8 TELKKSTRAIKAAILIQKWYRRYEARLEARR----RCTWQIFQS   47 (631)
T ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHHHHHHHH----hhHHHHHhH
Confidence            4455666667889999999999999987654    335555565


No 26 
>KOG0942|consensus
Probab=73.77  E-value=5.9  Score=35.85  Aligned_cols=37  Identities=24%  Similarity=0.284  Sum_probs=26.5

Q ss_pred             HhhhHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHhccc
Q psy16531         43 RLGKIVGWMQSYMRGYLSRKEYKKI-QEQSQSDLLNPR   79 (104)
Q Consensus        43 ~l~~~a~~iQ~~~RG~l~Rr~y~~~-r~~~~A~~~IQ~   79 (104)
                      +-...|+.+|+.||||.+|++.+.. |.+-.+...-++
T Consensus        27 k~e~~av~vQs~~Rg~~~r~~~~~~~R~~fd~~~~~~~   64 (1001)
T KOG0942|consen   27 KQEKNAVKVQSFWRGFRVRHNQKLLFREEFDAVSTRSR   64 (1001)
T ss_pred             HHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcC
Confidence            4456789999999999999997654 444445544444


No 27 
>PF15157 IQ-like:  IQ-like
Probab=61.20  E-value=10  Score=25.15  Aligned_cols=22  Identities=32%  Similarity=0.351  Sum_probs=17.3

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHH
Q psy16531         44 LGKIVGWMQSYMRGYLSRKEYK   65 (104)
Q Consensus        44 l~~~a~~iQ~~~RG~l~Rr~y~   65 (104)
                      +..-+.+||++||-|++|.-..
T Consensus        46 Leskvkiiqrawre~lq~qd~~   67 (97)
T PF15157_consen   46 LESKVKIIQRAWREYLQRQDPL   67 (97)
T ss_pred             hhHHHHHHHHHHHHHHHhcCCc
Confidence            4455788999999999987643


No 28 
>PTZ00014 myosin-A; Provisional
Probab=42.37  E-value=43  Score=29.96  Aligned_cols=22  Identities=23%  Similarity=0.084  Sum_probs=17.7

Q ss_pred             HHhhhHHHHHHHHHHHHHHHHH
Q psy16531         42 DRLGKIVGWMQSYMRGYLSRKE   63 (104)
Q Consensus        42 ~~l~~~a~~iQ~~~RG~l~Rr~   63 (104)
                      ......++.||+.||||+.++.
T Consensus       797 ~~~~~~~~~iQ~~~R~~l~~~~  818 (821)
T PTZ00014        797 RKNIKSLVRIQAHLRRHLVIAE  818 (821)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhc
Confidence            3445678999999999999864


No 29 
>PF05924 SAMP:  SAMP Motif;  InterPro: IPR009224 This short region is found repeated in the mid region of the adenomatous polyposis proteins (APCs). This motif binds axin [].; GO: 0008013 beta-catenin binding, 0016055 Wnt receptor signaling pathway; PDB: 1EMU_B 2RQU_B.
Probab=28.43  E-value=20  Score=17.34  Aligned_cols=11  Identities=18%  Similarity=0.169  Sum_probs=8.1

Q ss_pred             hhhhhhccccc
Q psy16531         92 TLPIAISCDNN  102 (104)
Q Consensus        92 ~~~~~~~~~~~  102 (104)
                      +++|...|+++
T Consensus         2 ~deiL~~CI~s   12 (20)
T PF05924_consen    2 EDEILQECIGS   12 (20)
T ss_dssp             -HHHHHHHHHC
T ss_pred             HHHHHHHHHHH
Confidence            55888888876


No 30 
>PF11430 EGL-1:  Programmed cell death activator EGL-1;  InterPro: IPR021543  Initiation of programmed cell death in C.elegans occurs by the binding of EGL-1 to CED-9 which disrupts a complex involving CED-4/CED-9 and allows CED-4 to activate CED-3, a caspase. It is the C-terminal domain of EGL-1 which is involved in the formation of the complex with CED-9. The formation of the complex induces structural rearrangements in CED-9 and EGL-1 adopts an extended alpha-helical conformation []. ; PDB: 1TY4_D.
Probab=24.92  E-value=15  Score=17.97  Aligned_cols=11  Identities=36%  Similarity=0.640  Sum_probs=8.2

Q ss_pred             hhhhhcccccC
Q psy16531         93 LPIAISCDNND  103 (104)
Q Consensus        93 ~~~~~~~~~~~  103 (104)
                      ..++.+|++||
T Consensus         5 ~kla~MCDdFD   15 (21)
T PF11430_consen    5 TKLAAMCDDFD   15 (21)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            36778888876


No 31 
>KOG0165|consensus
Probab=24.13  E-value=1.3e+02  Score=27.44  Aligned_cols=24  Identities=21%  Similarity=0.454  Sum_probs=20.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHH
Q psy16531         45 GKIVGWMQSYMRGYLSRKEYKKIQ   68 (104)
Q Consensus        45 ~~~a~~iQ~~~RG~l~Rr~y~~~r   68 (104)
                      ...++.||.++||+.+|++|+...
T Consensus       943 Kkaavviqkmirgfiarrkfqmei  966 (1023)
T KOG0165|consen  943 KKAAVVIQKMIRGFIARRKFQMEI  966 (1023)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHH
Confidence            456899999999999999998753


No 32 
>KOG1419|consensus
Probab=22.74  E-value=95  Score=27.13  Aligned_cols=26  Identities=19%  Similarity=0.215  Sum_probs=18.1

Q ss_pred             HHHHHHHH----hhhHHHHHHHHHHHHHHH
Q psy16531         36 MEELRDDR----LGKIVGWMQSYMRGYLSR   61 (104)
Q Consensus        36 LE~~R~~~----l~~~a~~iQ~~~RG~l~R   61 (104)
                      =|+.|.+-    ..-+|.+||.+||-|.+-
T Consensus       327 Qeq~RQKHf~rrr~pAA~LIQc~WR~yaa~  356 (654)
T KOG1419|consen  327 QEQHRQKHFNRRRNPAASLIQCAWRYYAAE  356 (654)
T ss_pred             HHHHHHHHHHhhcchHHHHHHHHHHHHhcc
Confidence            35566553    345789999999977654


No 33 
>PF08763 Ca_chan_IQ:  Voltage gated calcium channel IQ domain;  InterPro: IPR014873 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers. Voltage-dependent Ca2+ channels (VDCC) are a family of molecules that allow cells to couple electrical activity to intracellular Ca2+ signalling. The opening and closing of these channels by depolarizing stimuli, such as action potentials, allows Ca2+ ions to enter neurons down a steep electrochemical gradient, producing transient intracellular Ca2+ signals. Many of the processes that occur in neurons, including transmitter release, gene transcription and metabolism are controlled by Ca2+ influx occurring simultaneously at different cellular locales. The pore is formed by the alpha-1 subunit which incorporates the conduction pore, the voltage sensor and gating apparatus, and the known sites of channel regulation by second messengers, drugs, and toxins []. The activity of this pore is modulated by 4 tightly-coupled subunits: an intracellular beta subunit; a transmembrane gamma subunit; and a disulphide-linked complex of alpha-2 and delta subunits, which are proteolytically cleaved from the same gene product. Properties of the protein including gating voltage-dependence, G protein modulation and kinase susceptibility can be influenced by these subunits. Voltage-gated calcium channels are classified as T, L, N, P, Q and R, and are distinguished by their sensitivity to pharmacological blocks, single-channel conductance kinetics, and voltage-dependence. On the basis of their voltage activation properties, the voltage-gated calcium classes can be further divided into two broad groups: the low (T-type) and high (L, N, P, Q and R-type) threshold-activated channels. The voltage-gated calcium channel alpha 1 subunit contains an IQ domain, named for its isoleucine-glutamine (IQ) motif, which interacts with hydrophobic pockets of Ca2+/calmodulin []. The interaction regulates two self-regulatory calcium dependent feedback mechanisms, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF). ; PDB: 3OXQ_F 2F3Z_B 3G43_E 2F3Y_B 2BE6_D 3DVM_B 3BXK_D 2VAY_B 3DVK_B 3BXL_B ....
Probab=20.56  E-value=1.6e+02  Score=16.03  Aligned_cols=17  Identities=35%  Similarity=0.540  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy16531         47 IVGWMQSYMRGYLSRKE   63 (104)
Q Consensus        47 ~a~~iQ~~~RG~l~Rr~   63 (104)
                      ++.+||-.||.+..|+.
T Consensus        11 At~lI~dyfr~~K~rk~   27 (35)
T PF08763_consen   11 ATLLIQDYFRQFKKRKE   27 (35)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45689999998887764


Done!