Query         psy16532
Match_columns 84
No_of_seqs    104 out of 375
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:41:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16532.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16532hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3382|consensus               99.7 1.4E-18   3E-23  125.6   3.6   58   27-84     27-84  (151)
  2 PLN02732 Probable NADH dehydro  99.7 7.7E-17 1.7E-21  117.4   5.2   50   30-79     17-82  (159)
  3 PLN03095 NADH:ubiquinone oxido  99.6   5E-16 1.1E-20  108.2   4.3   40   40-79      3-42  (115)
  4 PRK06630 hypothetical protein;  99.6 1.5E-15 3.3E-20  104.0   3.2   40   40-79      6-47  (99)
  5 PRK08183 NADH dehydrogenase; V  99.5 3.7E-15 8.1E-20  105.7   3.6   52   28-79      7-61  (133)
  6 PF05071 NDUFA12:  NADH ubiquin  99.4 1.2E-13 2.6E-18   93.0   4.1   33   47-79      1-34  (105)
  7 COG3761 NADH:ubiquinone oxidor  99.1 1.4E-11 3.1E-16   86.4   1.5   36   45-80     11-48  (118)
  8 PF15613 WHIM2:  WSTF, HB1, Itc  93.8   0.029 6.3E-07   32.5   1.0   15   48-62      3-17  (38)
  9 PF11385 DUF3189:  Protein of u  42.3      19 0.00042   25.7   1.9   19   45-63     48-68  (148)
 10 cd01717 Sm_B The eukaryotic Sm  41.2      17 0.00036   22.8   1.3   18   45-62     23-40  (79)
 11 PF06739 SBBP:  Beta-propeller   34.7      31 0.00067   19.1   1.6   17   46-62     14-30  (38)
 12 cd06168 LSm9 The eukaryotic Sm  33.6      26 0.00057   22.3   1.3   19   45-63     23-41  (75)
 13 smart00651 Sm snRNP Sm protein  31.7      28  0.0006   20.4   1.1   21   43-63     19-39  (67)
 14 cd00600 Sm_like The eukaryotic  27.4      42  0.0009   19.3   1.3   22   43-64     17-38  (63)
 15 cd01727 LSm8 The eukaryotic Sm  26.4      40 0.00086   20.9   1.2   20   45-64     22-41  (74)
 16 smart00604 MD MD domain.        24.5      49  0.0011   24.2   1.5   12   48-59    131-142 (145)
 17 cd01729 LSm7 The eukaryotic Sm  23.1      51  0.0011   21.0   1.2   18   44-61     24-41  (81)
 18 smart00456 WW Domain with 2 co  21.8 1.3E+02  0.0027   15.2   3.0   27   47-75      4-30  (32)
 19 TIGR00723 ttdB_fumA_fumB hydro  21.6      50  0.0011   24.5   1.1   26   36-61    141-167 (168)
 20 KOG0909|consensus               21.2      40 0.00086   29.1   0.6   67    3-75    199-266 (500)
 21 COG1838 FumA Tartrate dehydrat  21.0      35 0.00076   25.9   0.2   38   26-63    138-176 (184)
 22 PRK08395 fumarate hydratase; P  20.4      54  0.0012   24.2   1.0   26   36-61    137-162 (162)

No 1  
>KOG3382|consensus
Probab=99.73  E-value=1.4e-18  Score=125.62  Aligned_cols=58  Identities=55%  Similarity=0.898  Sum_probs=54.9

Q ss_pred             cccchhHHHhhhhccCccccceEEeecCCCCEEeeeCCCCCCcccEEEeCCccccccC
Q psy16532         27 RCTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKFGLNYD   84 (84)
Q Consensus        27 ~c~~~~~~~~~L~r~~t~k~G~lVG~D~fGNKYYE~~~~~~GRrRWViY~~~~~~~Yd   84 (84)
                      .=||-+.++..|++..+.+.|+|||+|.|||||||++.++.||+|||+|+.+.+|+||
T Consensus        27 e~Gglr~~~~k~yrtd~~kiGTLVG~DkfGNkYyen~~~fygRhRWVeya~kv~~Dyd   84 (151)
T KOG3382|consen   27 EEGGLRCLLDKLYRTDDHKIGTLVGVDKFGNKYYENNDYFYGRHRWVEYASKVNWDYD   84 (151)
T ss_pred             hhccHHHHHHHHHhcccccceeeeeecccccchhcccceecccceeEEeccccccccc
Confidence            3478889999999999999999999999999999999989999999999999999997


No 2  
>PLN02732 Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit
Probab=99.66  E-value=7.7e-17  Score=117.37  Aligned_cols=50  Identities=44%  Similarity=0.645  Sum_probs=45.2

Q ss_pred             chhHHHhhhhccCccc-----------c----ceEEeecCCCCEEeeeCC-CCCCcccEEEeCCcc
Q psy16532         30 DRYDSSESSDRTDDLK-----------F----GTLVGVDKLGNKYYENKH-YFYGRNRWVVYHEKF   79 (84)
Q Consensus        30 ~~~~~~~~L~r~~t~k-----------~----G~lVG~D~fGNKYYE~~~-~~~GRrRWViY~~~~   79 (84)
                      |+.+++++|++++++|           .    |+|||+|+|||||||++. ...||+|||||+++.
T Consensus        17 G~~~~~~~l~~~g~~k~~~~g~t~gt~~~~~~G~lVG~D~~GNkYYE~~~~~~~grrRWV~Y~~~~   82 (159)
T PLN02732         17 GLGGFLRMLREEGYLRCLADGNLLQTKIHNIGATLVGVDKFGNKYYQKLGDTQYGRHRWVEYAEKS   82 (159)
T ss_pred             hHHHHHHHHHHccchhhccCcceeeeEEEeeCcEEEEecCCCCeeeecCCCCCCCceeEEEeCCCc
Confidence            8999999999999977           6    999999999999999985 466899999999864


No 3  
>PLN03095 NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional
Probab=99.61  E-value=5e-16  Score=108.22  Aligned_cols=40  Identities=50%  Similarity=0.821  Sum_probs=36.2

Q ss_pred             ccCccccceEEeecCCCCEEeeeCCCCCCcccEEEeCCcc
Q psy16532         40 RTDDLKFGTLVGVDKLGNKYYENKHYFYGRNRWVVYHEKF   79 (84)
Q Consensus        40 r~~t~k~G~lVG~D~fGNKYYE~~~~~~GRrRWViY~~~~   79 (84)
                      +++++|.|.|||+|+|||||||++....|++|||||++..
T Consensus         3 ~~~~~r~g~lVG~D~~GNkYYE~~~~~~~rrRWV~Y~~~~   42 (115)
T PLN03095          3 LVLASRAGRLVGEDEFGNKYYENPSYQSGRHRWVEYADKD   42 (115)
T ss_pred             ceeeeecceEeEEcCCCCeeeEcCCCCCCCeEEEEeCCCc
Confidence            4678999999999999999999987777899999999864


No 4  
>PRK06630 hypothetical protein; Provisional
Probab=99.56  E-value=1.5e-15  Score=104.05  Aligned_cols=40  Identities=30%  Similarity=0.464  Sum_probs=33.7

Q ss_pred             ccCccccceEEeecCCCCEEeeeCC--CCCCcccEEEeCCcc
Q psy16532         40 RTDDLKFGTLVGVDKLGNKYYENKH--YFYGRNRWVVYHEKF   79 (84)
Q Consensus        40 r~~t~k~G~lVG~D~fGNKYYE~~~--~~~GRrRWViY~~~~   79 (84)
                      .+++++.|+|||+|+|||+|||+..  ...+++|||||++..
T Consensus         6 ~~~t~r~G~lVG~D~~GNkYYE~~~~~~~gr~rRWViY~g~~   47 (99)
T PRK06630          6 KFFITFFHKKVGEDEFLNQYYESRNIDYLGRPRRFVIYKNVN   47 (99)
T ss_pred             hhhhhccCeEeEEeCCCChhcccCCCccCCCceEEEEeCCCC
Confidence            5788999999999999999999964  333569999999854


No 5  
>PRK08183 NADH dehydrogenase; Validated
Probab=99.54  E-value=3.7e-15  Score=105.74  Aligned_cols=52  Identities=27%  Similarity=0.390  Sum_probs=41.7

Q ss_pred             ccchhHHHhhhhccCccccceEEeecCCCCEEeeeCCC---CCCcccEEEeCCcc
Q psy16532         28 CTDRYDSSESSDRTDDLKFGTLVGVDKLGNKYYENKHY---FYGRNRWVVYHEKF   79 (84)
Q Consensus        28 c~~~~~~~~~L~r~~t~k~G~lVG~D~fGNKYYE~~~~---~~GRrRWViY~~~~   79 (84)
                      -++||....--.+++++|.|+|||+|++||||||+++.   ..+++|||+|++..
T Consensus         7 if~ww~g~t~~t~~~~~r~g~lVG~D~~GNkYYE~~~~~~~~~~~rRWV~Y~~~~   61 (133)
T PRK08183          7 IFTWWNGQTLGTRFFTWRKGERVGEDEFGNVYYRTKGGKPSDGRERRWVIYNGYA   61 (133)
T ss_pred             HHHHhccCchhheeehhccCeEeEecCCCCeeeecCCccccCCCceEEEEeCCCC
Confidence            35666665555678899999999999999999999873   34579999999854


No 6  
>PF05071 NDUFA12:  NADH ubiquinone oxidoreductase subunit NDUFA12;  InterPro: IPR007763  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. this entry represents the 17.2kDa subunit from NADH:ubiquinone oxidoreductase and its homologues []. This subunit is believed to be one of the 36 structural complex I proteins.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0009055 electron carrier activity, 0016020 membrane
Probab=99.43  E-value=1.2e-13  Score=93.05  Aligned_cols=33  Identities=58%  Similarity=0.900  Sum_probs=29.5

Q ss_pred             ceEEeecCCCCEEeeeC-CCCCCcccEEEeCCcc
Q psy16532         47 GTLVGVDKLGNKYYENK-HYFYGRNRWVVYHEKF   79 (84)
Q Consensus        47 G~lVG~D~fGNKYYE~~-~~~~GRrRWViY~~~~   79 (84)
                      |+|||+|+|||+|||++ ....+++|||+|++..
T Consensus         1 G~lVG~D~~GN~YyE~~~~~~~~~rRwV~y~~~~   34 (105)
T PF05071_consen    1 GTLVGTDEFGNKYYENPRDEQGRRRRWVEYAGKS   34 (105)
T ss_pred             CCEeeEeCCCCEEEeecCCCcCCCcEEEEcCCcc
Confidence            78999999999999999 4566789999999876


No 7  
>COG3761 NADH:ubiquinone oxidoreductase 17.2 kD subunit [Energy production and conversion]
Probab=99.14  E-value=1.4e-11  Score=86.39  Aligned_cols=36  Identities=42%  Similarity=0.749  Sum_probs=30.0

Q ss_pred             ccceEEeecCCCCEEeee-CCCCCCc-ccEEEeCCccc
Q psy16532         45 KFGTLVGVDKLGNKYYEN-KHYFYGR-NRWVVYHEKFG   80 (84)
Q Consensus        45 k~G~lVG~D~fGNKYYE~-~~~~~GR-rRWViY~~~~~   80 (84)
                      ++-+.||+|+|||.|||. .....|| ||||||++.++
T Consensus        11 rfh~kvGeDefgN~Yye~r~~ds~gr~RRwVIYngyaE   48 (118)
T COG3761          11 RFHKKVGEDEFGNVYYEGRNIDSEGRTRRWVIYNGYAE   48 (118)
T ss_pred             HHHHhccchhccceeeeccCCccCCCeeeEEEEcCcch
Confidence            345899999999999998 4456676 99999999765


No 8  
>PF15613 WHIM2:  WSTF, HB1, Itc1p, MBD9 motif 2
Probab=93.84  E-value=0.029  Score=32.51  Aligned_cols=15  Identities=33%  Similarity=0.656  Sum_probs=13.2

Q ss_pred             eEEeecCCCCEEeee
Q psy16532         48 TLVGVDKLGNKYYEN   62 (84)
Q Consensus        48 ~lVG~D~fGNKYYE~   62 (84)
                      +.+|.|.+||+||--
T Consensus         3 ~pLG~DR~~NrYwwf   17 (38)
T PF15613_consen    3 KPLGKDRYGNRYWWF   17 (38)
T ss_pred             ccccccCCCceEEEE
Confidence            568999999999974


No 9  
>PF11385 DUF3189:  Protein of unknown function (DUF3189);  InterPro: IPR021525  This family of proteins with unknown function appears to be restricted to Firmicutes 
Probab=42.28  E-value=19  Score=25.70  Aligned_cols=19  Identities=32%  Similarity=0.588  Sum_probs=15.2

Q ss_pred             ccce--EEeecCCCCEEeeeC
Q psy16532         45 KFGT--LVGVDKLGNKYYENK   63 (84)
Q Consensus        45 k~G~--lVG~D~fGNKYYE~~   63 (84)
                      ..|+  ++|+|++||.=|--.
T Consensus        48 d~G~l~y~G~De~gn~VY~lG   68 (148)
T PF11385_consen   48 DIGRLIYMGTDEYGNEVYILG   68 (148)
T ss_pred             cCceEEEEEEcCCCCEEEEEe
Confidence            4565  599999999998754


No 10 
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit B heterodimerizes with subunit D3 and three such heterodimers form a hexameric ring structure with alternating B and D3 subunits.  The D3 - B heterodimer also assembles into a heptameric ring containing D1, D2, E, F, and G subunits.  Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=41.18  E-value=17  Score=22.84  Aligned_cols=18  Identities=22%  Similarity=0.248  Sum_probs=14.6

Q ss_pred             ccceEEeecCCCCEEeee
Q psy16532         45 KFGTLVGVDKLGNKYYEN   62 (84)
Q Consensus        45 k~G~lVG~D~fGNKYYE~   62 (84)
                      -.|.|+|.|+|.|-=-++
T Consensus        23 ~~G~L~~~D~~~NlVL~~   40 (79)
T cd01717          23 FVGQFLAFDKHMNLVLSD   40 (79)
T ss_pred             EEEEEEEEcCccCEEcCC
Confidence            379999999999976444


No 11 
>PF06739 SBBP:  Beta-propeller repeat;  InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller. SBBP stands for Seven Bladed Beta Propeller.
Probab=34.72  E-value=31  Score=19.11  Aligned_cols=17  Identities=35%  Similarity=0.626  Sum_probs=13.8

Q ss_pred             cceEEeecCCCCEEeee
Q psy16532         46 FGTLVGVDKLGNKYYEN   62 (84)
Q Consensus        46 ~G~lVG~D~fGNKYYE~   62 (84)
                      .+.-|..|..||-|--.
T Consensus        14 ~~~~IavD~~GNiYv~G   30 (38)
T PF06739_consen   14 YGNGIAVDSNGNIYVTG   30 (38)
T ss_pred             eEEEEEECCCCCEEEEE
Confidence            46779999999998653


No 12 
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm9 proteins have a single Sm-like domain structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=33.55  E-value=26  Score=22.26  Aligned_cols=19  Identities=16%  Similarity=0.151  Sum_probs=15.1

Q ss_pred             ccceEEeecCCCCEEeeeC
Q psy16532         45 KFGTLVGVDKLGNKYYENK   63 (84)
Q Consensus        45 k~G~lVG~D~fGNKYYE~~   63 (84)
                      ..|+|+|.|+++|-=-.+-
T Consensus        23 ~~G~l~~~D~~~NivL~~~   41 (75)
T cd06168          23 LVGVFLCTDRDCNIILGSA   41 (75)
T ss_pred             EEEEEEEEcCCCcEEecCc
Confidence            3699999999999875543


No 13 
>smart00651 Sm snRNP Sm proteins. small nuclear ribonucleoprotein particles (snRNPs) involved in pre-mRNA splicing
Probab=31.70  E-value=28  Score=20.41  Aligned_cols=21  Identities=33%  Similarity=0.305  Sum_probs=17.2

Q ss_pred             ccccceEEeecCCCCEEeeeC
Q psy16532         43 DLKFGTLVGVDKLGNKYYENK   63 (84)
Q Consensus        43 t~k~G~lVG~D~fGNKYYE~~   63 (84)
                      ..-.|.|++.|++.|-.-++-
T Consensus        19 ~~~~G~L~~~D~~~NlvL~~~   39 (67)
T smart00651       19 REYRGTLKGFDQFMNLVLEDV   39 (67)
T ss_pred             cEEEEEEEEECccccEEEccE
Confidence            445799999999999987654


No 14 
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=27.39  E-value=42  Score=19.27  Aligned_cols=22  Identities=27%  Similarity=0.285  Sum_probs=17.2

Q ss_pred             ccccceEEeecCCCCEEeeeCC
Q psy16532         43 DLKFGTLVGVDKLGNKYYENKH   64 (84)
Q Consensus        43 t~k~G~lVG~D~fGNKYYE~~~   64 (84)
                      ..-.|.+++.|++.|---.+..
T Consensus        17 ~~~~G~L~~~D~~~Ni~L~~~~   38 (63)
T cd00600          17 RVLEGVLVAFDKYMNLVLDDVE   38 (63)
T ss_pred             cEEEEEEEEECCCCCEEECCEE
Confidence            3447999999999998776643


No 15 
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm8 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=26.45  E-value=40  Score=20.90  Aligned_cols=20  Identities=35%  Similarity=0.534  Sum_probs=16.1

Q ss_pred             ccceEEeecCCCCEEeeeCC
Q psy16532         45 KFGTLVGVDKLGNKYYENKH   64 (84)
Q Consensus        45 k~G~lVG~D~fGNKYYE~~~   64 (84)
                      -.|.|.|-|+|.|--=++..
T Consensus        22 ~~G~L~~~D~~~NlvL~~~~   41 (74)
T cd01727          22 IVGTLKGFDQATNLILDDSH   41 (74)
T ss_pred             EEEEEEEEccccCEEccceE
Confidence            36899999999998777643


No 16 
>smart00604 MD MD domain.
Probab=24.49  E-value=49  Score=24.19  Aligned_cols=12  Identities=33%  Similarity=0.628  Sum_probs=10.5

Q ss_pred             eEEeecCCCCEE
Q psy16532         48 TLVGVDKLGNKY   59 (84)
Q Consensus        48 ~lVG~D~fGNKY   59 (84)
                      .++|.|++||.|
T Consensus       131 ~i~G~D~~G~~F  142 (145)
T smart00604      131 LIDGVDENGYNF  142 (145)
T ss_pred             EEEeecCCCcee
Confidence            568999999987


No 17 
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm7 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=23.08  E-value=51  Score=21.02  Aligned_cols=18  Identities=33%  Similarity=0.301  Sum_probs=14.1

Q ss_pred             cccceEEeecCCCCEEee
Q psy16532         44 LKFGTLVGVDKLGNKYYE   61 (84)
Q Consensus        44 ~k~G~lVG~D~fGNKYYE   61 (84)
                      .-.|.|+|-|+|-|-==+
T Consensus        24 ~~~G~L~~~D~~mNlvL~   41 (81)
T cd01729          24 EVTGILKGYDQLLNLVLD   41 (81)
T ss_pred             EEEEEEEEEcCcccEEec
Confidence            347999999999996544


No 18 
>smart00456 WW Domain with 2 conserved Trp (W) residues. Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides.
Probab=21.83  E-value=1.3e+02  Score=15.15  Aligned_cols=27  Identities=26%  Similarity=0.331  Sum_probs=17.2

Q ss_pred             ceEEeecCCCCEEeeeCCCCCCcccEEEe
Q psy16532         47 GTLVGVDKLGNKYYENKHYFYGRNRWVVY   75 (84)
Q Consensus        47 G~lVG~D~fGNKYYE~~~~~~GRrRWViY   75 (84)
                      |-.+-.|..|..||-+...  ++.+|..+
T Consensus         4 gW~~~~~~~g~~yy~n~~t--~~s~W~~P   30 (32)
T smart00456        4 GWEERKDPDGRPYYYNHET--KETQWEKP   30 (32)
T ss_pred             CCEEEECCCCCEEEEECCC--CCEEcCCC
Confidence            3445566669999998642  45666543


No 19 
>TIGR00723 ttdB_fumA_fumB hydro-lyases, Fe-S type, tartrate/fumarate subfamily, beta region. A number of Fe-S cluster-containing hydro-lyases share a conserved motif, including argininosuccinate lyase, adenylosuccinate lyase, aspartase, class I fumarate hydratase (fumarase), and tartrate dehydratase. This model represents a subset of closely related proteins or modules, including the E. coli tartrate dehydratase beta chain and the C-terminal region of the class I fumarase (where the N-terminal region is homologous to the tartrate dehydratase alpha chain). The activity of archaeal proteins in this subfamily has not been established.
Probab=21.58  E-value=50  Score=24.46  Aligned_cols=26  Identities=23%  Similarity=0.357  Sum_probs=18.3

Q ss_pred             hhhhccCcccc-ceEEeecCCCCEEee
Q psy16532         36 ESSDRTDDLKF-GTLVGVDKLGNKYYE   61 (84)
Q Consensus        36 ~~L~r~~t~k~-G~lVG~D~fGNKYYE   61 (84)
                      ..+|.+--..+ =-+|..|.+||..|+
T Consensus       141 EAi~~leVedfGPliV~iDs~Gn~ly~  167 (168)
T TIGR00723       141 EAIWELEVEDFGPLIVAIDSHGNSIFQ  167 (168)
T ss_pred             cEEEEEEEecceeEEEEEECCCCcccc
Confidence            44455544445 346999999999986


No 20 
>KOG0909|consensus
Probab=21.22  E-value=40  Score=29.12  Aligned_cols=67  Identities=25%  Similarity=0.332  Sum_probs=42.9

Q ss_pred             cccccceecccCCCCCCchhhhhccccchhHHHhhhhccCccccceE-EeecCCCCEEeeeCCCCCCcccEEEe
Q psy16532          3 SCDQETQFVSNCSDHENDETCRKKRCTDRYDSSESSDRTDDLKFGTL-VGVDKLGNKYYENKHYFYGRNRWVVY   75 (84)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~k~c~~~~~~~~~L~r~~t~k~G~l-VG~D~fGNKYYE~~~~~~GRrRWViY   75 (84)
                      .|.+++.|--- .|...=-.-||-|||-|-.-|.-|++.+.....-. =-+|+-=+-+|.+..     .|||--
T Consensus       199 ~C~~~~RFPRY-Ndp~kLLeTRkGRCGEWANCFTllcralg~daR~i~d~tDHVWtEvYS~~q-----qRW~Hv  266 (500)
T KOG0909|consen  199 RCGTETRFPRY-NDPIKLLETRKGRCGEWANCFTLLCRALGLDARYIWDRTDHVWTEVYSNAQ-----QRWVHV  266 (500)
T ss_pred             CCCCcccCccc-CCHHHHHhhccCccchHHHHHHHHHHHcCCcceEEeecCcchhHHhhhhhh-----heeEee
Confidence            46666666321 12222235699999999999999999887644322 246776666666543     788743


No 21 
>COG1838 FumA Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain [Energy production and conversion]
Probab=20.99  E-value=35  Score=25.88  Aligned_cols=38  Identities=24%  Similarity=0.360  Sum_probs=26.7

Q ss_pred             ccccchhH-HHhhhhccCccccceEEeecCCCCEEeeeC
Q psy16532         26 KRCTDRYD-SSESSDRTDDLKFGTLVGVDKLGNKYYENK   63 (84)
Q Consensus        26 k~c~~~~~-~~~~L~r~~t~k~G~lVG~D~fGNKYYE~~   63 (84)
                      -+|--|.+ -...+|.+---..--+|..|..||.+|+..
T Consensus       138 ~~~v~~~dLGmEAiw~leVe~fPliV~iDs~Gn~~~~~~  176 (184)
T COG1838         138 VRCVAYEDLGMEAIWELEVEDFPLIVAIDSKGNSLFKEG  176 (184)
T ss_pred             eeeEeecccChhheeEEEeccccEEEEEeCCCcChhhhc
Confidence            45666655 335555555555667899999999999864


No 22 
>PRK08395 fumarate hydratase; Provisional
Probab=20.37  E-value=54  Score=24.15  Aligned_cols=26  Identities=23%  Similarity=0.350  Sum_probs=18.3

Q ss_pred             hhhhccCccccceEEeecCCCCEEee
Q psy16532         36 ESSDRTDDLKFGTLVGVDKLGNKYYE   61 (84)
Q Consensus        36 ~~L~r~~t~k~G~lVG~D~fGNKYYE   61 (84)
                      ..+|.+--..+=-+|+.|.+||..|+
T Consensus       137 EAi~~leVedfP~iV~iDs~Gn~ly~  162 (162)
T PRK08395        137 DAVWELEVEDFPLLVAIDSKGRSLYR  162 (162)
T ss_pred             cEEEEEEEecCcEEEEEeCCCCcccC
Confidence            44555544445568999999999885


Done!