BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy16544
         (63 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8)
          Length = 325

 Score = 26.9 bits (58), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 5   YIH------SILSDQALFEKYEDFMVRRVLSIEPDARWCPT 39
           Y+H      ++L D  L  K  DF + RVL  +PDA +  T
Sbjct: 172 YVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAAYTTT 212


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.142    0.454 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,923,230
Number of Sequences: 62578
Number of extensions: 59441
Number of successful extensions: 138
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 137
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 14,973,337
effective HSP length: 34
effective length of query: 29
effective length of database: 12,845,685
effective search space: 372524865
effective search space used: 372524865
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)