Diaphorina citri psyllid: psy1654


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MVSNEDVVREMMKKDDAFFKNKEAMSDLFLKRLKFGTAGIRGPMGVGFSQMNDVVIIQTGQGILSCAEKHIPNFKESGIIVGYDGRHNSKRFAELTASVFLNGGVKRVFLVSRVCPTPIIAYSIRALNLALGIMITASHNPKEDNGYKLYDSKGCQIISPIDKQIQEEIMRNLEIEDHIWNIDRIRDQIQPCPLDSVLEKYGQSVLDGAYDLGLNEKSQVVITYSAMHGVGYPYVNQLFKLFKFKPLVLVDAQCSPDPEFPTVRFPNPEEPSSLDLAVKTADQHGSTVILANDPDADRLAVAEKAKDGQWKIFTGNELGALFGWWALHRLKSKQPNAPLQDYYFLASTVSSKILHTIAQAEGLKYDETLTGFKWMGTKTYDLEQEGKHVLLAFEEAIGFMDGTHVLDKDGVTAAVRMAELVAYLDSQGKDLHQLLADVYDKGNCITGGFIDPKSKREED
ccccHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccCEEEEcccccccHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHcccccEEEEcccccccccccEEEcccccccccHHHHHHHHHHHHccccccccccHHHHHccccccccHHHHHHHHHHHHHccccccccccccccEEEccccccccHHHHHHHHHccccccEEcccccccccccccccccccccHHHHHHHHHHHHHccccEEEcccccccEEEEEEEcccccEEEEccHHHHHHHHHHHHHccHHccccccccccEEEEcccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEccccccccc
**SNEDVVREMMKKDDAFFKNKEAMSDLFLKRLKFGTAGIRGPMGVGFSQMNDVVIIQTGQGILSCAEKHIPNFKESGIIVGYDGRHNSKRFAELTASVFLNGGVKRVFLVSRVCPTPIIAYSIRALNLALGIMITASHNPKEDNGYKLYDSKGCQIISPIDKQIQEEIMRNLEIEDHIWNIDRIRDQIQPCPLDSVLEKYGQSVLDGAYDLGLNEKSQVVITYSAMHGVGYPYVNQLFKLFKFKPLVLVDAQCSPDPEFPTVRFPNPEEPSSLDLAVKTADQHGSTVILANDPDADRLAVAEKAKDGQWKIFTGNELGALFGWWALHRLKSKQPNAPLQDYYFLASTVSSKILHTIAQAEGLKYDETLTGFKWMGTKTYDLEQEGKHVLLAFEEAIGFMDGTHVLDKDGVTAAVRMAELVAYLDSQGKDLHQLLADVYDKGNCITGGFIDPKSK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSNEDVVREMMKKDDAFFKNKEAMSDLFLKRLKFGTAGIRGPMGVGFSQMNDVVIIQTGQGILSCAEKHIPNFKESGIIVGYDGRHNSKRFAELTASVFLNGGVKRVFLVSRVCPTPIIAYSIRALNLALGIMITASHNPKEDNGYKLYDSKGCQIISPIDKQIQEEIMRNLEIEDHIWNIDRIRDQIQPCPLDSVLEKYGQSVLDGAYDLGLNEKSQVVITYSAMHGVGYPYVNQLFKLFKFKPLVLVDAQCSPDPEFPTVRFPNPEEPSSLDLAVKTADQHGSTVILANDPDADRLAVAEKAKDGQWKIFTGNELGALFGWWALHRLKSKQPNAPLQDYYFLASTVSSKILHTIAQAEGLKYDETLTGFKWMGTKTYDLEQEGKHVLLAFEEAIGFMDGTHVLDKDGVTAAVRMAELVAYLDSQGKDLHQLLADVYDKGNCITGGFIDPKSKREED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphoglucomutase Catalyzes the interconversion between glucose-6-phosphate and alpha-glucose-1-phosphate. This is the first step in the biosynthesis of diglucosyl-diacylglycerol (Glc2-DAG), i.e. the predominant glycolipid found in B.subtilis membrane, which is also used as a membrane anchor for lipoteichoic acid (LTA). Has a role in the biosynthesis of all phosphate-containing envelope polymers, since glucose-1-phosphate is the precursor of UDP-glucose, which serves as a glucosyl donor not only for the biosynthesis of LTA but also for wall teichoic acids (WTAs). Is required for biofilm formation. This is likely due to another role of UDP-glucose, which might also act as a metabolic signal regulating biofilm formation or may be involved in some unknown biosynthetic pathway essential for biofilm formation, e.g. the synthesis of an exopolysaccharide.confidentP18159
Phosphoglucomutase Catalyzes the interconversion between glucose-6-phosphate and alpha-glucose-1-phosphate. This is the first step in the biosynthesis of diglucosyl-diacylglycerol (Glc2-DAG), i.e. the predominant glycolipid found in the S.aureus membrane, which is also used as a membrane anchor for lipoteichoic acid (LTA).confidentQ99RE2
Phosphoglucomutase Catalyzes the interconversion between glucose-6-phosphate and alpha-glucose-1-phosphate. This is the first step in the biosynthesis of diglucosyl-diacylglycerol (Glc2-DAG), i.e. the predominant glycolipid found in the S.aureus membrane, which is also used as a membrane anchor for lipoteichoic acid (LTA).confidentQ2YW66

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0047933 [MF]glucose-1,6-bisphosphate synthase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0008973 [MF]phosphopentomutase activityprobableGO:0016866, GO:0003824, GO:0003674, GO:0016853, GO:0016868
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z0F, chain A
Confidence level:very confident
Coverage over the Query: 14-252,277-454
View the alignment between query and template
View the model in PyMOL
Template: 1JDY, chain A
Confidence level:probable
Coverage over the Query: 34-441
View the alignment between query and template
View the model in PyMOL