Diaphorina citri psyllid: psy16559


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
LLIQEEWEKEQKRLRDIEEKNRQEKEEREAQEKEFKKSIEDFIEGVCNELPDGFRTNVETKPDKELCPFYSKVGACRFFDHCSRNHIKPSVSKTLLLNNFFTHLSMDNKSVREYDTDINLEFDETEMHKYFVEFYDDVLPELRSLGQVTQFKVCCNKSPHLRGNVYVSYSNEREALRAFYALTGRFYGGKQIRGQFCNVPLWSKAMC
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEccHHHHHHHHHHHcccCCccCEEEEEECcccccccccc
LLIQEE********************************IEDFIEGVCNELPDGFRTNVETKPDKELCPFYSKVGACRFFDHCSRNHIKPSVSKTLLLNNFFTHLSMDNKSVREYDTDINLEFDETEMHKYFVEFYDDVLPELRSLGQVTQFKVCCNKSPHLRGNVYVSYSNEREALRAFYALTGRFYGGKQIRGQFCNVPLWSKAMC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LLIQEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFIEGVCNELPDGFRTNVETKPDKELCPFYSKVGACRFFDHCSRNHIKPSVSKTLLLNNFFTHLSMDNKSVREYDTDINLEFDETEMHKYFVEFYDDVLPELRSLGQVTQFKVCCNKSPHLRGNVYVSYSNEREALRAFYALTGRFYGGKQIRGQFCNVPLWSKAMC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor U2AF 23 kDa subunit Necessary for the splicing of pre-mRNA. The SF1-U2AF59-U2AF23 complex has a role in the recognition of the branch site (5'-UACUAAC-3'), the pyrimidine tract and the 3'-splice site at the 3'-end of introns.confidentQ09176

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000243 [CC]commitment complexprobableGO:0005575, GO:0005622, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005684, GO:0043227, GO:0043226, GO:0005681
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005488 [MF]bindingprobableGO:0003674
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0045292 [BP]mRNA cis splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397
GO:0000349 [BP]generation of catalytic spliceosome for first transesterification stepprobableGO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000393, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JMT, chain A
Confidence level:very confident
Coverage over the Query: 92-105,116-198
View the alignment between query and template
View the model in PyMOL
Template: 3U1L, chain A
Confidence level:confident
Coverage over the Query: 65-198
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 5-42
View the alignment between query and template
View the model in PyMOL