RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy16587
         (130 letters)



>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2
           domain and Transmembrane region Proteins (MCTP).  MCTPs
           are involved in Ca2+ signaling at the membrane.  MCTP is
           composed of a variable N-terminal sequence, three C2
           domains, two transmembrane regions (TMRs), and a short
           C-terminal sequence.  It is one of four protein classes
           that are anchored to membranes via a transmembrane
           region; the others being synaptotagmins, extended
           synaptotagmins, and ferlins. MCTPs are the only
           membrane-bound C2 domain proteins that contain two
           functional TMRs. MCTPs are unique in that they bind Ca2+
           but not phospholipids. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 121

 Score = 75.4 bits (186), Expect = 9e-19
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (1%)

Query: 10  VELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYP 69
           + ++VFDYD GL DDFMGSA +DL+TLEL + T++ L LEDPN  +E+LG I L  TL P
Sbjct: 63  LYIKVFDYDRGLTDDFMGSAFVDLSTLELNKPTEVKLKLEDPNS-DEDLGYISLVVTLTP 121


>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in
           Tricalbin-like proteins.  5 to 6 copies of the C2 domain
           are present in Tricalbin, a yeast homolog of
           Synaptotagmin, which is involved in membrane trafficking
           and sorting.  C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the fifth C2
           repeat, C2E, and has a type-II topology.
          Length = 115

 Score = 39.5 bits (93), Expect = 5e-05
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 9   VVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLS 64
           V++++V+D+D G +DD +GSA IDL+ LE    T+L L L+        LG ++L 
Sbjct: 62  VLKVEVYDWDRGGKDDLLGSAYIDLSDLEPEETTELTLPLDGQGG--GKLGAVFLP 115


>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third
           repeat in Synaptotagmin-like proteins.  Synaptotagmin is
           a membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains either the
           first or third repeat in Synaptotagmin-like proteins
           with a type-I topology.
          Length = 121

 Score = 38.0 bits (89), Expect = 2e-04
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 5   TSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLED 50
             G  +E+++FD D   +DDF+G  SIDL ++E     D  L LED
Sbjct: 65  VPGQELEIELFDEDPD-KDDFLGRLSIDLGSVEKKGFIDEWLPLED 109


>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2
           domain and Transmembrane region Proteins (MCTP).  MCTPs
           are involved in Ca2+ signaling at the membrane.  MCTP is
           composed of a variable N-terminal sequence, three C2
           domains, two transmembrane regions (TMRs), and a short
           C-terminal sequence.  It is one of four protein classes
           that are anchored to membranes via a transmembrane
           region; the others being synaptotagmins, extended
           synaptotagmins, and ferlins. MCTPs are the only
           membrane-bound C2 domain proteins that contain two
           functional TMRs. MCTPs are unique in that they bind Ca2+
           but not phospholipids. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 116

 Score = 37.2 bits (87), Expect = 4e-04
 Identities = 17/43 (39%), Positives = 27/43 (62%)

Query: 9   VVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDP 51
           ++E++V+D D G +D+F+G   IDL+ L   +   L L LED 
Sbjct: 62  ILEIEVWDKDTGKKDEFIGRCEIDLSALPREQTHSLELELEDG 104


>gnl|CDD|175973 cd00030, C2, C2 domain.  The C2 domain was first identified in
          PKC. C2 domains fold into an 8-standed beta-sandwich
          that can adopt 2 structural arrangements: Type I and
          Type II, distinguished by a circular permutation
          involving their N- and C-terminal beta strands. Many C2
          domains are Ca2+-dependent membrane-targeting modules
          that bind a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 102

 Score = 36.7 bits (85), Expect = 5e-04
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 9  VVELQVFDYDWGLQDDFMGSASIDLTTLE 37
           + ++V+D D   +DDF+G   I L+ L 
Sbjct: 62 TLTVEVWDKDRFSKDDFLGEVEIPLSELL 90


>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB).
          Ca2+-binding motif present in phospholipases, protein
          kinases C, and synaptotagmins (among others). Some do
          not appear to contain Ca2+-binding sites. Particular
          C2s appear to bind phospholipids, inositol
          polyphosphates, and intracellular proteins. Unusual
          occurrence in perforin. Synaptotagmin and PLC C2s are
          permuted in sequence with respect to N- and C-terminal
          beta strands. SMART detects C2 domains using one or
          both of two profiles.
          Length = 101

 Score = 35.9 bits (83), Expect = 0.001
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 9  VVELQVFDYDWGLQDDFMGSASIDLTTLELG 39
           +E++V+D D   +DDF+G  +I L+ L LG
Sbjct: 65 ELEIEVYDKDRFGRDDFIGQVTIPLSDLLLG 95


>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating
          Proteins (GAP).  ArfGAP is a GTPase activating protein
          which regulates the ADP ribosylation factor Arf, a
          member of the Ras superfamily of GTP-binding proteins. 
          The GTP-bound form of Arf is involved in Golgi
          morphology and is involved in recruiting coat proteins.
           ArfGAP is responsible for the GDP-bound form of Arf
          which is necessary for uncoating the membrane and
          allowing the Golgi to fuse with an acceptor
          compartment.  These proteins contain an N-terminal
          ArfGAP domain containing the characteristic zinc finger
          motif (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2
          domain. C2 domains were first identified in Protein
          Kinase C (PKC). C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 145

 Score = 35.4 bits (82), Expect = 0.003
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 8  LVVELQVFDYDWGLQDDFMGSASIDLTTL 36
            ++L+VFD D   +DD MG A IDL  L
Sbjct: 61 APLKLEVFDKDTFSKDDSMGEAEIDLEPL 89


>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2
            domain [General function prediction only].
          Length = 1227

 Score = 32.8 bits (75), Expect = 0.035
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 9    VVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLY 68
            V+ + V D+D G ++D +G+A IDL+ LE G  T+        N P +    I L  TL+
Sbjct: 1103 VLTINVNDWDSGEKNDLLGTAEIDLSKLEPGGTTNS-------NIPLDGKTFIVLDGTLH 1155

Query: 69   P 69
            P
Sbjct: 1156 P 1156



 Score = 25.9 bits (57), Expect = 8.1
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 12  LQVFDYDWGLQDDFMGSASIDLTTLE 37
           L ++D++    D  +GS  +DL  L 
Sbjct: 503 LSLYDFNSFKSDKVVGSTQLDLALLH 528


>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 30.0 bits (68), Expect = 0.20
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 9   VVELQVFDYDWGLQDDFMGSASIDLTTLELG 39
           V+ LQV DYD   ++D +G  S+ L  ++L 
Sbjct: 84  VLYLQVLDYDRFSRNDPIGEVSLPLNKVDLT 114


>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in
           Synaptotagmin-like proteins.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 29.7 bits (67), Expect = 0.21
 Identities = 13/66 (19%), Positives = 29/66 (43%), Gaps = 5/66 (7%)

Query: 7   GLVVELQVFDYDWGLQDDFMGSASIDLT---TLELGRCTDLILTLEDPNKPEENL--GDI 61
             +++L ++D D     D++G   I L           +D  +TL+     + ++  G+I
Sbjct: 63  NQLLKLILWDKDRFAGKDYLGEFDIALEEVFADGKTGQSDKWITLKSTRPGKTSVVSGEI 122

Query: 62  YLSATL 67
           +L  + 
Sbjct: 123 HLQFSW 128


>gnl|CDD|215765 pfam00168, C2, C2 domain. 
          Length = 85

 Score = 29.2 bits (66), Expect = 0.22
 Identities = 8/22 (36%), Positives = 15/22 (68%)

Query: 9  VVELQVFDYDWGLQDDFMGSAS 30
           + ++V+DYD   +DDF+G  +
Sbjct: 64 ELRIEVYDYDRFGKDDFIGEVT 85


>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin.  Ferlins are
           involved in vesicle fusion events.  Ferlins and other
           proteins, such as Synaptotagmins, are implicated in
           facilitating the fusion process when cell membranes fuse
           together.  There are six known human Ferlins: Dysferlin
           (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3),
           Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can
           lead to a wide range of diseases including muscular
           dystrophy (dysferlin), deafness (otoferlin), and
           infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 127

 Score = 29.1 bits (66), Expect = 0.39
 Identities = 12/45 (26%), Positives = 22/45 (48%)

Query: 9   VVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNK 53
            +E+ V DY+   ++  +GSA++ L  L      ++   L D N 
Sbjct: 58  SLEIVVKDYEKVGRNRLIGSATVSLQDLVSEGLLEVTEPLLDSNG 102


>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the fifth C2 repeat,
          C2E, and has a type-II topology.
          Length = 124

 Score = 28.7 bits (65), Expect = 0.44
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 10 VELQVFDYDWGLQDDFMGSASIDL 33
          +++ V DYD    DD +G   IDL
Sbjct: 65 LKISVMDYDLLGSDDLIGETVIDL 88


>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present
          in the putative elicitor-responsive gene.  In plants
          elicitor-responsive proteins are triggered in response
          to specific elicitor molecules such as glycolproteins,
          peptides, carbohydrates and lipids. A host of defensive
          responses are also triggered resulting in localized
          cell death.  Antimicrobial secondary metabolites, such
          as phytoalexins, or defense-related proteins, including
          pathogenesis-related (PR) proteins  are also produced. 
          There is a single C2 domain present here.  C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. Members have a type-II topology.
          Length = 124

 Score = 28.1 bits (63), Expect = 0.89
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 12 LQVFDYDWGLQDDFMGSASIDLTTL-ELGR 40
          L++ D D    DDF+G A+I L  L E G 
Sbjct: 70 LRIMDKDNFSDDDFIGEATIHLKGLFEEGV 99


>gnl|CDD|185171 PRK15263, PRK15263, putative fimbrial protein StaE; Provisional.
          Length = 196

 Score = 27.8 bits (62), Expect = 1.4
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 27 GSASIDLT---TLELGRCTDLILTLEDPNKPEENLGDIYLS 64
          G+ S+ LT   T+E+G CT  ++   D        GD+Y+S
Sbjct: 23 GTDSLGLTVNTTVEMGTCTAQLVDDSDTPISTIAFGDVYIS 63


>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in
           Rabphilin and Double C2 domain.  Rabphilin is found
           neurons and in neuroendrocrine cells, while Doc2 is
           found not only in the brain but in tissues, including
           mast cells, chromaffin cells, and osteoblasts.
           Rabphilin and Doc2s share highly homologous tandem C2
           domains, although their N-terminal structures are
           completely different: rabphilin contains an N-terminal
           Rab-binding domain (RBD),7 whereas Doc2 contains an
           N-terminal Munc13-1-interacting domain (MID). C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 133

 Score = 27.3 bits (61), Expect = 1.5
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 7/30 (23%)

Query: 11  ELQVFDYDWGLQDDFMGSASIDLTTLELGR 40
           E+ V+D D G  +D++G        L+LG 
Sbjct: 84  EITVWDKDIGKSNDYIGG-------LQLGI 106


>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family
          interacting proteins (FIP) class I.  Rab GTPases
          recruit various effector proteins to organelles and
          vesicles.  Rab11-family interacting proteins (FIPs) are
          involved in mediating the role of Rab11. FIPs can be
          divided into three classes: class I FIPs (Rip11a,
          Rip11b, RCP, and FIP2) which contain a C2 domain after
          N-terminus of the protein, class II FIPs (FIP3 and
          FIP4) which contain two EF-hands and a proline rich
          region, and class III FIPs (FIP1) which exhibits no
          homology to known protein domains. All FIP proteins
          contain a highly conserved, 20-amino acid motif at the
          C-terminus of the protein, known as Rab11/25 binding
          domain (RBD).  Class I FIPs are thought to bind to
          endocytic membranes via their C2 domain, which
          interacts directly with phospholipids. Class II FIPs do
          not have any membrane binding domains leaving much to
          speculate about the mechanism involving FIP3 and FIP4
          interactions with endocytic membranes. The members in
          this CD are class I FIPs.  The exact function of the
          Rab11 and FIP interaction is unknown, but there is
          speculation that it involves the role of forming a
          targeting complex that recruits a group of proteins
          involved in membrane transport to organelles. The C2
          domain was first identified in PKC. C2 domains fold
          into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins. Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain. C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 126

 Score = 27.0 bits (60), Expect = 2.3
 Identities = 9/29 (31%), Positives = 14/29 (48%)

Query: 9  VVELQVFDYDWGLQDDFMGSASIDLTTLE 37
           ++L V   +    D F+G  SI L  L+
Sbjct: 66 TLQLTVMHRNLLGLDKFLGQVSIPLNDLD 94


>gnl|CDD|116179 pfam07560, DUF1539, Domain of Unknown Function (DUF1539). 
          Length = 126

 Score = 26.6 bits (59), Expect = 2.7
 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%)

Query: 70  RSQEDRDQEASGTSESYSQKCTDLILTLEDPNKPEE 105
            S ED   E      S   K   LIL L+DP  P E
Sbjct: 52  TSPEDESHEDQALFRSTMHK---LILALKDPTIPTE 84


>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-II topology.
          Length = 124

 Score = 26.0 bits (58), Expect = 4.2
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 12 LQVFDYDWGLQDDFMGSASIDLTTLE 37
          L V+D++   +D  +G+A  DL++L 
Sbjct: 69 LTVYDFNDKRKDKLIGTAEFDLSSLL 94


>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in
           Rab3-interacting molecule (RIM) proteins.  RIMs are
           believed to organize specialized sites of the plasma
           membrane called active zones.  They also play a role in
           controlling neurotransmitter release, plasticity
           processes, as well as memory and learning.  RIM contains
           an N-terminal zinc finger domain, a PDZ domain, and two
           C-terminal C2 domains (C2A, C2B).  C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology and do not bind Ca2+.
          Length = 125

 Score = 26.1 bits (58), Expect = 4.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 9   VVELQVFDYDWGLQDDFMGSASIDLTT 35
            +E+ V+DYD   ++DF+G   IDL  
Sbjct: 86  TLEVTVWDYDRDGENDFLGEVVIDLAD 112


>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC)
           alpha and gamma.  A single C2 domain is found in PKC
           alpha and gamma. The PKC family of serine/threonine
           kinases regulates apoptosis, proliferation, migration,
           motility, chemo-resistance, and differentiation.  There
           are 3 groups: group 1(alpha, betaI, beta II, gamma)
           which require phospholipids and calcium, group 2 (delta,
           epsilon, theta, eta) which do not require calcium for
           activation, and group 3 (xi, iota/lambda) which are
           atypical and can be activated in the absence of
           diacylglycerol and calcium. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology.
          Length = 131

 Score = 25.7 bits (57), Expect = 6.2
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 2/30 (6%)

Query: 8   LVVELQVFDYDWGLQDDFMGSASIDLTTLE 37
           L +E  V+D+D   ++DFMGS S  ++ L 
Sbjct: 82  LSIE--VWDWDRTTRNDFMGSLSFGVSELI 109


>gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional.
          Length = 120

 Score = 25.4 bits (56), Expect = 7.6
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 5/28 (17%)

Query: 10 VELQVFDYDWGLQDDFMGSASIDLTTLE 37
          V +QV D+D     ++ G AS+ L TLE
Sbjct: 54 VLVQVVDFD-----EYTGKASLSLRTLE 76


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.310    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0645    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,332,960
Number of extensions: 527118
Number of successful extensions: 274
Number of sequences better than 10.0: 1
Number of HSP's gapped: 274
Number of HSP's successfully gapped: 31
Length of query: 130
Length of database: 10,937,602
Length adjustment: 86
Effective length of query: 44
Effective length of database: 7,123,158
Effective search space: 313418952
Effective search space used: 313418952
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 53 (24.4 bits)