Query         psy16592
Match_columns 132
No_of_seqs    114 out of 305
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 16:54:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16592.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16592hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2930|consensus              100.0 5.5E-34 1.2E-38  212.2   4.2   69   60-131    19-87  (114)
  2 COG5194 APC11 Component of SCF 100.0 2.9E-32 6.2E-37  195.4   4.9   60   68-131     1-60  (88)
  3 PF12861 zf-Apc11:  Anaphase-pr  99.9 1.5E-27 3.3E-32  170.4   5.2   57   68-131     1-58  (85)
  4 KOG1493|consensus               99.9 4.3E-26 9.3E-31  162.5   1.8   57   68-131     1-57  (84)
  5 PF12678 zf-rbx1:  RING-H2 zinc  99.9 2.7E-23 5.8E-28  141.4   5.6   56   69-131     1-56  (73)
  6 PF13639 zf-RING_2:  Ring finge  95.5  0.0065 1.4E-07   36.8   1.0   27   88-131     1-27  (44)
  7 PHA02926 zinc finger-like prot  80.1    0.68 1.5E-05   39.2   0.5   33   87-131   170-203 (242)
  8 PHA02929 N1R/p28-like protein;  75.0     1.7 3.8E-05   36.1   1.5   34   86-131   173-206 (238)
  9 PF10571 UPF0547:  Uncharacteri  73.6     1.6 3.5E-05   25.0   0.8   24  100-130     2-25  (26)
 10 KOG1734|consensus               70.6     1.6 3.4E-05   38.2   0.4   37   85-131   222-258 (328)
 11 PF13832 zf-HC5HC2H_2:  PHD-zin  65.8     2.5 5.5E-05   29.6   0.5   19   87-106    55-73  (110)
 12 PF15227 zf-C3HC4_4:  zinc fing  58.5     5.5 0.00012   24.4   1.0   10   90-99      1-10  (42)
 13 cd00162 RING RING-finger (Real  52.8     6.8 0.00015   21.7   0.7   11  121-131    14-24  (45)
 14 COG5243 HRD1 HRD ubiquitin lig  52.4     7.9 0.00017   35.5   1.4   39   86-131   286-324 (491)
 15 PF14634 zf-RING_5:  zinc-RING   51.9     9.3  0.0002   23.1   1.3   11  120-130    15-25  (44)
 16 PF08776 VASP_tetra:  VASP tetr  50.9      22 0.00048   22.7   2.9   18   33-50     12-29  (40)
 17 PF10367 Vps39_2:  Vacuolar sor  49.6      14  0.0003   25.0   2.0   28   87-132    78-105 (109)
 18 PF13771 zf-HC5HC2H:  PHD-like   47.7     7.6 0.00017   26.1   0.5   20   86-106    35-54  (90)
 19 PF11793 FANCL_C:  FANCL C-term  45.5     6.2 0.00014   26.6  -0.2   12   87-98      2-13  (70)
 20 PF06677 Auto_anti-p27:  Sjogre  42.5     8.1 0.00017   24.3  -0.0   17   83-99     13-29  (41)
 21 KOG0309|consensus               41.4      11 0.00024   37.4   0.6   35   88-130  1019-1053(1081)
 22 PF13923 zf-C3HC4_2:  Zinc fing  38.7      16 0.00034   21.4   0.8   12  119-130    11-22  (39)
 23 KOG4628|consensus               37.5      18 0.00039   32.0   1.3   27   88-131   230-256 (348)
 24 PF08738 Gon7:  Gon7 family;  I  35.8      35 0.00075   25.3   2.4   22   32-53     65-87  (103)
 25 KOG0802|consensus               35.7      19 0.00042   32.4   1.3   31   86-131   290-320 (543)
 26 COG5540 RING-finger-containing  32.2      25 0.00055   31.4   1.4   27   88-131   324-350 (374)
 27 PF02318 FYVE_2:  FYVE-type zin  31.9      92   0.002   22.6   4.1   22   86-107    53-80  (118)
 28 smart00184 RING Ring finger. E  31.6      22 0.00047   18.8   0.6   11  121-131    12-22  (39)
 29 PF12907 zf-met2:  Zinc-binding  31.5      11 0.00024   23.7  -0.7   12   89-100     3-14  (40)
 30 KOG3026|consensus               28.4      48   0.001   28.6   2.4   19   30-48      9-35  (262)
 31 PF13717 zinc_ribbon_4:  zinc-r  26.7      28 0.00061   20.8   0.5   31  100-130     4-36  (36)
 32 KOG1813|consensus               26.4      24 0.00051   31.1   0.2   13   88-100   242-254 (313)
 33 PRK13718 conjugal transfer pro  26.4      67  0.0014   23.5   2.5   22   68-89     17-38  (84)
 34 KOG2034|consensus               25.4      28 0.00061   34.5   0.5   27   86-130   816-842 (911)
 35 COG4357 Zinc finger domain con  25.3      24 0.00052   26.7   0.0   20   88-107    63-89  (105)
 36 TIGR02116 toxin_Txe_YoeB toxin  22.8 2.4E+02  0.0052   18.7   5.5   50   33-84     19-69  (80)
 37 PF14835 zf-RING_6:  zf-RING of  22.4      32 0.00069   23.9   0.2   12  119-130    20-31  (65)
 38 PF10550 Toxin_36:  Conantokin-  20.6      83  0.0018   16.3   1.5   11   38-48      2-12  (15)
 39 KOG0320|consensus               20.2      39 0.00084   27.8   0.3    9  121-129   147-155 (187)
 40 PF02132 RecR:  RecR protein;    20.1      32 0.00069   21.0  -0.2   11   86-96     28-38  (41)
 41 cd00049 MH1 MH1 is a small DNA  20.1 1.6E+02  0.0034   22.3   3.6   13   75-87     75-88  (121)

No 1  
>KOG2930|consensus
Probab=100.00  E-value=5.5e-34  Score=212.16  Aligned_cols=69  Identities=45%  Similarity=0.903  Sum_probs=62.7

Q ss_pred             CCCCCCCcccEEEEEEEEEEEeEEecCCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         60 LRSEYPDVPRFTVRKFNAVALWSWDMDMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        60 ~~~~~~~~~RfkIKkWnAVA~WsWDi~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      .++.++...||+||||||||+|+|||.+|+|||||||+|++|++||++. ++  +.++|.|+||+|||+||.
T Consensus        19 ~~s~~~~~krF~lKKWnAvAlWaWDi~vDnCAICRnHIMd~CieCQa~~-~~--~~~EC~VaWG~CNHaFH~   87 (114)
T KOG2930|consen   19 SSSNEGGKKRFELKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ-SA--TSEECTVAWGVCNHAFHF   87 (114)
T ss_pred             cccCCCCCcceEEeeeeeeeeeeeeeeechhHHHHHHHHHHHHhhccCC-CC--CCCceEEEeeecchHHHH
Confidence            3444455899999999999999999999999999999999999999997 56  789999999999999994


No 2  
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]
Probab=99.97  E-value=2.9e-32  Score=195.44  Aligned_cols=60  Identities=40%  Similarity=0.906  Sum_probs=57.1

Q ss_pred             ccEEEEEEEEEEEeEEecCCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         68 PRFTVRKFNAVALWSWDMDMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        68 ~RfkIKkWnAVA~WsWDi~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      |||+||+||+||+|+||+..|+|||||||||++||+||++.  +  |+++||+|||.|||+||.
T Consensus         1 ~kvkIkkw~aVa~Wswdi~id~CaICRnhim~~C~eCq~~~--~--~~~eC~v~wG~CnHaFH~   60 (88)
T COG5194           1 MKVKIKKWHAVALWSWDIPIDVCAICRNHIMGTCPECQFGM--T--PGDECPVVWGVCNHAFHD   60 (88)
T ss_pred             CceEeeeEeEEEEEecccccchhhhhhccccCcCcccccCC--C--CCCcceEEEEecchHHHH
Confidence            68999999999999999999999999999999999999964  4  899999999999999994


No 3  
>PF12861 zf-Apc11:  Anaphase-promoting complex subunit 11 RING-H2 finger
Probab=99.94  E-value=1.5e-27  Score=170.43  Aligned_cols=57  Identities=26%  Similarity=0.753  Sum_probs=55.1

Q ss_pred             ccEEEEEEEEEEEeEEec-CCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         68 PRFTVRKFNAVALWSWDM-DMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        68 ~RfkIKkWnAVA~WsWDi-~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      |+|+||+||+||.|+||+ .+|+|||||+.|+++||+|+.       |||+||+|||.|+|+||+
T Consensus         1 mkv~i~~w~~va~W~Wd~~~dd~CgICr~~fdg~Cp~Ck~-------Pgd~Cplv~g~C~H~FH~   58 (85)
T PF12861_consen    1 MKVKIKEWHAVATWKWDVANDDVCGICRMPFDGCCPDCKF-------PGDDCPLVWGKCSHNFHM   58 (85)
T ss_pred             CeeEEEEEEEEEEEEEecCCCCceeeEecccccCCCCccC-------CCCCCceeeccCccHHHH
Confidence            789999999999999997 599999999999999999988       999999999999999997


No 4  
>KOG1493|consensus
Probab=99.92  E-value=4.3e-26  Score=162.52  Aligned_cols=57  Identities=32%  Similarity=0.844  Sum_probs=55.7

Q ss_pred             ccEEEEEEEEEEEeEEecCCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         68 PRFTVRKFNAVALWSWDMDMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        68 ~RfkIKkWnAVA~WsWDi~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      |+|+||+||+||.|+||..+++|||||++|+++||+|+.       |||+||+|||.|.|+||.
T Consensus         1 Mkvki~~~h~~a~wtW~~~~e~CGiCRm~Fdg~Cp~Ck~-------PgDdCPLv~G~C~h~fh~   57 (84)
T KOG1493|consen    1 MKVKIKRYHAVAWWTWDAPDETCGICRMPFDGCCPDCKL-------PGDDCPLVWGYCLHAFHA   57 (84)
T ss_pred             CceEEEEEEEEEEEEEcCCCCccceEecccCCcCCCCcC-------CCCCCccHHHHHHHHHHH
Confidence            789999999999999999999999999999999999998       999999999999999995


No 5  
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=99.88  E-value=2.7e-23  Score=141.45  Aligned_cols=56  Identities=45%  Similarity=0.987  Sum_probs=52.7

Q ss_pred             cEEEEEEEEEEEeEEecCCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         69 RFTVRKFNAVALWSWDMDMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        69 RfkIKkWnAVA~WsWDi~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      ||+||+|++|+.|+||+.+|+||||+++|+++|++|++       ++++|++++|.|||.||.
T Consensus         1 ~~~i~~~~~v~~~~~~~~~d~C~IC~~~l~~~~~~~~~-------~~~~~~i~~~~C~H~FH~   56 (73)
T PF12678_consen    1 KFKIKKWNAVALWSWDIADDNCAICREPLEDPCPECQA-------PQDECPIVWGPCGHIFHF   56 (73)
T ss_dssp             SEEEEEEEEEEEEEESSCCSBETTTTSBTTSTTCCHHH-------CTTTS-EEEETTSEEEEH
T ss_pred             CeEEEEEEEEEEEeecCcCCcccccChhhhChhhhhcC-------CccccceEecccCCCEEH
Confidence            69999999999999999999999999999999999999       568899999999999995


No 6  
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=95.47  E-value=0.0065  Score=36.81  Aligned_cols=27  Identities=19%  Similarity=0.236  Sum_probs=17.9

Q ss_pred             CceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         88 ETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        88 D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      |.|+||...|.+      .          +=++.. .|||.||.
T Consensus         1 d~C~IC~~~~~~------~----------~~~~~l-~C~H~fh~   27 (44)
T PF13639_consen    1 DECPICLEEFED------G----------EKVVKL-PCGHVFHR   27 (44)
T ss_dssp             -CETTTTCBHHT------T----------SCEEEE-TTSEEEEH
T ss_pred             CCCcCCChhhcC------C----------CeEEEc-cCCCeeCH
Confidence            689999888866      1          112334 49999994


No 7  
>PHA02926 zinc finger-like protein; Provisional
Probab=80.07  E-value=0.68  Score=39.17  Aligned_cols=33  Identities=12%  Similarity=0.030  Sum_probs=23.1

Q ss_pred             CCceeccccccccc-ccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         87 METCAICRNHLMDE-CILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        87 ~D~CAICRn~f~d~-CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      ++.||||...+.+. ++.++.       .|     +...|+|+|.+
T Consensus       170 E~eCgICmE~I~eK~~~~eRr-------FG-----IL~~CnHsFCl  203 (242)
T PHA02926        170 EKECGICYEVVYSKRLENDRY-------FG-----LLDSCNHIFCI  203 (242)
T ss_pred             CCCCccCcccccccccccccc-------cc-----ccCCCCchHHH
Confidence            79999999877654 444433       12     66789999964


No 8  
>PHA02929 N1R/p28-like protein; Provisional
Probab=74.96  E-value=1.7  Score=36.14  Aligned_cols=34  Identities=21%  Similarity=0.195  Sum_probs=21.6

Q ss_pred             CCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         86 DMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        86 ~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      .++.|+||-..+.+.-    .        .+....+...|+|.||.
T Consensus       173 ~~~eC~ICle~~~~~~----~--------~~~~~~vl~~C~H~FC~  206 (238)
T PHA02929        173 KDKECAICMEKVYDKE----I--------KNMYFGILSNCNHVFCI  206 (238)
T ss_pred             CCCCCccCCcccccCc----c--------ccccceecCCCCCcccH
Confidence            3578999988765421    0        12223456689999985


No 9  
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=73.61  E-value=1.6  Score=24.98  Aligned_cols=24  Identities=17%  Similarity=0.221  Sum_probs=15.6

Q ss_pred             cccccccccCCCCCCCCCCeeEEEecccccc
Q psy16592        100 ECILCQARDAQDEPPPNGCTVAWAFSLKSSS  130 (132)
Q Consensus       100 ~CpeCQan~~~~~~pgddCpVvwG~CgHsFH  130 (132)
                      .||+|......   ....||.    |||.|-
T Consensus         2 ~CP~C~~~V~~---~~~~Cp~----CG~~F~   25 (26)
T PF10571_consen    2 TCPECGAEVPE---SAKFCPH----CGYDFE   25 (26)
T ss_pred             cCCCCcCCchh---hcCcCCC----CCCCCc
Confidence            48888775432   2456764    899883


No 10 
>KOG1734|consensus
Probab=70.64  E-value=1.6  Score=38.23  Aligned_cols=37  Identities=8%  Similarity=-0.016  Sum_probs=23.6

Q ss_pred             cCCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         85 MDMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        85 i~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      .++.+||||-+.|+..=   ..       .|--=.+-.=.|||+||.
T Consensus       222 l~d~vCaVCg~~~~~s~---~e-------egvienty~LsCnHvFHE  258 (328)
T KOG1734|consen  222 LSDSVCAVCGQQIDVSV---DE-------EGVIENTYKLSCNHVFHE  258 (328)
T ss_pred             CCcchhHhhcchheeec---ch-------hhhhhhheeeecccchHH
Confidence            46789999999987643   11       111112235589999995


No 11 
>PF13832 zf-HC5HC2H_2:  PHD-zinc-finger like domain
Probab=65.80  E-value=2.5  Score=29.60  Aligned_cols=19  Identities=32%  Similarity=0.780  Sum_probs=16.0

Q ss_pred             CCceeccccccccccccccc
Q psy16592         87 METCAICRNHLMDECILCQA  106 (132)
Q Consensus        87 ~D~CAICRn~f~d~CpeCQa  106 (132)
                      ...|.||+.. .+.|+.|..
T Consensus        55 ~~~C~iC~~~-~G~~i~C~~   73 (110)
T PF13832_consen   55 KLKCSICGKS-GGACIKCSH   73 (110)
T ss_pred             CCcCcCCCCC-CceeEEcCC
Confidence            4689999999 788999955


No 12 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=58.52  E-value=5.5  Score=24.39  Aligned_cols=10  Identities=40%  Similarity=1.022  Sum_probs=5.1

Q ss_pred             eecccccccc
Q psy16592         90 CAICRNHLMD   99 (132)
Q Consensus        90 CAICRn~f~d   99 (132)
                      |.||...|.+
T Consensus         1 CpiC~~~~~~   10 (42)
T PF15227_consen    1 CPICLDLFKD   10 (42)
T ss_dssp             ETTTTSB-SS
T ss_pred             CCccchhhCC
Confidence            5566655544


No 13 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=52.83  E-value=6.8  Score=21.74  Aligned_cols=11  Identities=0%  Similarity=-0.463  Sum_probs=8.2

Q ss_pred             EEEeccccccc
Q psy16592        121 AWAFSLKSSSI  131 (132)
Q Consensus       121 vwG~CgHsFH~  131 (132)
                      ....|||.||.
T Consensus        14 ~~~~C~H~~c~   24 (45)
T cd00162          14 VLLPCGHVFCR   24 (45)
T ss_pred             EecCCCChhcH
Confidence            44569999984


No 14 
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]
Probab=52.43  E-value=7.9  Score=35.45  Aligned_cols=39  Identities=15%  Similarity=0.118  Sum_probs=25.1

Q ss_pred             CCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         86 DMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        86 ~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      .|.+|+||+-.++.+=-+ +.      +-|-+=.+-.=-|||.||.
T Consensus       286 ~D~~C~ICmde~~h~~~~-~~------~~~~~~~pKrLpCGHilHl  324 (491)
T COG5243         286 SDRTCTICMDEMFHPDHE-PL------PRGLDMTPKRLPCGHILHL  324 (491)
T ss_pred             CCCeEEEecccccCCCCc-cC------cccccCCcccccccceeeH
Confidence            468999999997765322 11      1233444455679999995


No 15 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=51.87  E-value=9.3  Score=23.09  Aligned_cols=11  Identities=0%  Similarity=-0.405  Sum_probs=8.9

Q ss_pred             eEEEecccccc
Q psy16592        120 VAWAFSLKSSS  130 (132)
Q Consensus       120 VvwG~CgHsFH  130 (132)
                      .....|||.|-
T Consensus        15 ~~l~~CgH~~C   25 (44)
T PF14634_consen   15 PRLTSCGHIFC   25 (44)
T ss_pred             eEEcccCCHHH
Confidence            67789999884


No 16 
>PF08776 VASP_tetra:  VASP tetramerisation domain;  InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein. This region corresponds to the tetramerisation domain which forms a right handed alpha helical coiled coil structure []. ; PDB: 1USE_A 1USD_A.
Probab=50.95  E-value=22  Score=22.71  Aligned_cols=18  Identities=44%  Similarity=0.455  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHhHhhhhh
Q psy16592         33 IQELINEELQKMKEDREL   50 (132)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~   50 (132)
                      |-+-+..||||||+.+-.
T Consensus        12 IL~EvrkEl~K~K~EIIe   29 (40)
T PF08776_consen   12 ILEEVRKELQKVKEEIIE   29 (40)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            444456699999987643


No 17 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=49.55  E-value=14  Score=24.96  Aligned_cols=28  Identities=11%  Similarity=0.125  Sum_probs=20.4

Q ss_pred             CCceecccccccccccccccccCCCCCCCCCCeeEEEecccccccC
Q psy16592         87 METCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSIY  132 (132)
Q Consensus        87 ~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~~  132 (132)
                      ...|++|...|..                  =+.+..-|||.||..
T Consensus        78 ~~~C~vC~k~l~~------------------~~f~~~p~~~v~H~~  105 (109)
T PF10367_consen   78 STKCSVCGKPLGN------------------SVFVVFPCGHVVHYS  105 (109)
T ss_pred             CCCccCcCCcCCC------------------ceEEEeCCCeEEecc
Confidence            5779998888743                  134677889999963


No 18 
>PF13771 zf-HC5HC2H:  PHD-like zinc-binding domain
Probab=47.67  E-value=7.6  Score=26.05  Aligned_cols=20  Identities=30%  Similarity=0.773  Sum_probs=16.2

Q ss_pred             CCCceeccccccccccccccc
Q psy16592         86 DMETCAICRNHLMDECILCQA  106 (132)
Q Consensus        86 ~~D~CAICRn~f~d~CpeCQa  106 (132)
                      ....|.+|+.. .+.|+.|..
T Consensus        35 ~~~~C~~C~~~-~Ga~i~C~~   54 (90)
T PF13771_consen   35 RKLKCSICKKK-GGACIGCSH   54 (90)
T ss_pred             hCCCCcCCCCC-CCeEEEEeC
Confidence            35789999977 688999955


No 19 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=45.45  E-value=6.2  Score=26.58  Aligned_cols=12  Identities=25%  Similarity=0.559  Sum_probs=4.9

Q ss_pred             CCceeccccccc
Q psy16592         87 METCAICRNHLM   98 (132)
Q Consensus        87 ~D~CAICRn~f~   98 (132)
                      +..|+||...+.
T Consensus         2 ~~~C~IC~~~~~   13 (70)
T PF11793_consen    2 ELECGICYSYRL   13 (70)
T ss_dssp             --S-SSS--SS-
T ss_pred             CCCCCcCCcEec
Confidence            457999988765


No 20 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=42.55  E-value=8.1  Score=24.28  Aligned_cols=17  Identities=41%  Similarity=0.798  Sum_probs=12.7

Q ss_pred             EecCCCceecccccccc
Q psy16592         83 WDMDMETCAICRNHLMD   99 (132)
Q Consensus        83 WDi~~D~CAICRn~f~d   99 (132)
                      |.+..+.|..|..+++.
T Consensus        13 ~~ML~~~Cp~C~~PL~~   29 (41)
T PF06677_consen   13 WTMLDEHCPDCGTPLMR   29 (41)
T ss_pred             HhHhcCccCCCCCeeEE
Confidence            45667888888888876


No 21 
>KOG0309|consensus
Probab=41.35  E-value=11  Score=37.37  Aligned_cols=35  Identities=20%  Similarity=0.494  Sum_probs=18.4

Q ss_pred             CceecccccccccccccccccCCCCCCCCCCeeEEEecccccc
Q psy16592         88 ETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSS  130 (132)
Q Consensus        88 D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH  130 (132)
                      ..|+||...++. |.-|....       -+-..+=|.|+|.-|
T Consensus      1019 ~~~~~~~~~~~~-C~~C~l~V-------~gss~~Cg~C~Hv~H 1053 (1081)
T KOG0309|consen 1019 TQCAICKGFTFQ-CAICHLAV-------RGSSNFCGTCGHVGH 1053 (1081)
T ss_pred             eeccccccceee-eeeEeeEe-------eccchhhcccccccc
Confidence            456666666655 44444421       111223388888776


No 22 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=38.68  E-value=16  Score=21.40  Aligned_cols=12  Identities=17%  Similarity=-0.175  Sum_probs=9.8

Q ss_pred             eeEEEecccccc
Q psy16592        119 TVAWAFSLKSSS  130 (132)
Q Consensus       119 pVvwG~CgHsFH  130 (132)
                      |++.-.|||.|.
T Consensus        11 ~~~~~~CGH~fC   22 (39)
T PF13923_consen   11 PVVVTPCGHSFC   22 (39)
T ss_dssp             EEEECTTSEEEE
T ss_pred             cCEECCCCCchh
Confidence            667789999985


No 23 
>KOG4628|consensus
Probab=37.47  E-value=18  Score=32.03  Aligned_cols=27  Identities=19%  Similarity=0.320  Sum_probs=16.9

Q ss_pred             CceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         88 ETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        88 D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      |+||||--.|.               .||.--+  =-|+|.||-
T Consensus       230 ~~CaIClEdY~---------------~GdklRi--LPC~H~FH~  256 (348)
T KOG4628|consen  230 DTCAICLEDYE---------------KGDKLRI--LPCSHKFHV  256 (348)
T ss_pred             ceEEEeecccc---------------cCCeeeE--ecCCCchhh
Confidence            59999854332               2444333  679999983


No 24 
>PF08738 Gon7:  Gon7 family;  InterPro: IPR014849 In Saccharomyces cerevisiae Gon7 is a member of the KEOPS protein complex. A protein complex proposed to be involved in transcription and promoting telomere uncapping and telomere elongation []. 
Probab=35.76  E-value=35  Score=25.35  Aligned_cols=22  Identities=36%  Similarity=0.546  Sum_probs=17.1

Q ss_pred             HHHHHHHHHH-HHhHhhhhhhcc
Q psy16592         32 QIQELINEEL-QKMKEDRELNRT   53 (132)
Q Consensus        32 ~~~~~~~~~~-~~~~~~~~~~~~   53 (132)
                      .+|.-||++| ++|++|-.....
T Consensus        65 ~lQddIN~fLTeRMe~dK~~~~~   87 (103)
T PF08738_consen   65 TLQDDINEFLTERMEEDKARDAQ   87 (103)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhhc
Confidence            5789999888 789988765544


No 25 
>KOG0802|consensus
Probab=35.73  E-value=19  Score=32.45  Aligned_cols=31  Identities=16%  Similarity=0.001  Sum_probs=20.5

Q ss_pred             CCCceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         86 DMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        86 ~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      .++.|.||+..+... .. ..             +-.=.|+|+||.
T Consensus       290 ~~~~C~IC~e~l~~~-~~-~~-------------~~rL~C~Hifh~  320 (543)
T KOG0802|consen  290 SDELCIICLEELHSG-HN-IT-------------PKRLPCGHIFHD  320 (543)
T ss_pred             cCCeeeeechhhccc-cc-cc-------------cceeecccchHH
Confidence            479999999887642 11 11             134579999984


No 26 
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=32.18  E-value=25  Score=31.44  Aligned_cols=27  Identities=15%  Similarity=0.301  Sum_probs=19.3

Q ss_pred             CceecccccccccccccccccCCCCCCCCCCeeEEEeccccccc
Q psy16592         88 ETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSSI  131 (132)
Q Consensus        88 D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH~  131 (132)
                      --||||-..|-      +         +|.  ++---|+|.||-
T Consensus       324 veCaICms~fi------K---------~d~--~~vlPC~H~FH~  350 (374)
T COG5540         324 VECAICMSNFI------K---------NDR--LRVLPCDHRFHV  350 (374)
T ss_pred             ceEEEEhhhhc------c---------cce--EEEeccCceech
Confidence            35999998882      1         233  566789999994


No 27 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=31.93  E-value=92  Score=22.57  Aligned_cols=22  Identities=27%  Similarity=0.662  Sum_probs=13.2

Q ss_pred             CCCceecccccc------cccccccccc
Q psy16592         86 DMETCAICRNHL------MDECILCQAR  107 (132)
Q Consensus        86 ~~D~CAICRn~f------~d~CpeCQan  107 (132)
                      .+-.|++|..+|      ...|.+|+..
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~   80 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHR   80 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEE
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCcc
Confidence            456899998765      2457777664


No 28 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=31.63  E-value=22  Score=18.80  Aligned_cols=11  Identities=0%  Similarity=-0.444  Sum_probs=8.1

Q ss_pred             EEEeccccccc
Q psy16592        121 AWAFSLKSSSI  131 (132)
Q Consensus       121 vwG~CgHsFH~  131 (132)
                      +.-.|+|.||.
T Consensus        12 ~~~~C~H~~c~   22 (39)
T smart00184       12 VVLPCGHTFCR   22 (39)
T ss_pred             EEecCCChHHH
Confidence            44569999973


No 29 
>PF12907 zf-met2:  Zinc-binding
Probab=31.45  E-value=11  Score=23.75  Aligned_cols=12  Identities=42%  Similarity=1.060  Sum_probs=9.9

Q ss_pred             ceeccccccccc
Q psy16592         89 TCAICRNHLMDE  100 (132)
Q Consensus        89 ~CAICRn~f~d~  100 (132)
                      .|.|||..|+..
T Consensus         3 ~C~iC~qtF~~t   14 (40)
T PF12907_consen    3 ICKICRQTFMQT   14 (40)
T ss_pred             CcHHhhHHHHhc
Confidence            699999888754


No 30 
>KOG3026|consensus
Probab=28.43  E-value=48  Score=28.56  Aligned_cols=19  Identities=53%  Similarity=0.711  Sum_probs=13.3

Q ss_pred             HHHHHHH--------HHHHHHHhHhhh
Q psy16592         30 KLQIQEL--------INEELQKMKEDR   48 (132)
Q Consensus        30 ~~~~~~~--------~~~~~~~~~~~~   48 (132)
                      |||+|..        -||||++|++|-
T Consensus         9 K~QLqqVeaaL~~dP~NeEllkLe~DL   35 (262)
T KOG3026|consen    9 KLQLQQVEAALQGDPENEELLKLEKDL   35 (262)
T ss_pred             HHHHHHHHHHHccCCccHHHHHHHHHH
Confidence            5666543        289999998764


No 31 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=26.70  E-value=28  Score=20.83  Aligned_cols=31  Identities=29%  Similarity=0.361  Sum_probs=15.9

Q ss_pred             cccccccccCCC--CCCCCCCeeEEEecccccc
Q psy16592        100 ECILCQARDAQD--EPPPNGCTVAWAFSLKSSS  130 (132)
Q Consensus       100 ~CpeCQan~~~~--~~pgddCpVvwG~CgHsFH  130 (132)
                      .|+.|++...-+  .-|+..=.+-=+.|+|.|+
T Consensus         4 ~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~f~   36 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKIPPKGRKVRCSKCGHVFF   36 (36)
T ss_pred             ECCCCCCEEeCCHHHCCCCCcEEECCCCCCEeC
Confidence            588887753311  0022222233357888885


No 32 
>KOG1813|consensus
Probab=26.37  E-value=24  Score=31.10  Aligned_cols=13  Identities=31%  Similarity=0.646  Sum_probs=10.5

Q ss_pred             Cceeccccccccc
Q psy16592         88 ETCAICRNHLMDE  100 (132)
Q Consensus        88 D~CAICRn~f~d~  100 (132)
                      +.|.|||..|..+
T Consensus       242 f~c~icr~~f~~p  254 (313)
T KOG1813|consen  242 FKCFICRKYFYRP  254 (313)
T ss_pred             ccccccccccccc
Confidence            4599999999754


No 33 
>PRK13718 conjugal transfer protein TrbE; Provisional
Probab=26.37  E-value=67  Score=23.47  Aligned_cols=22  Identities=36%  Similarity=0.581  Sum_probs=16.4

Q ss_pred             ccEEEEEEEEEEEeEEecCCCc
Q psy16592         68 PRFTVRKFNAVALWSWDMDMET   89 (132)
Q Consensus        68 ~RfkIKkWnAVA~WsWDi~~D~   89 (132)
                      ..+++.=..+|-.||||..-++
T Consensus        17 LtvT~IViSPviywSWDtVK~T   38 (84)
T PRK13718         17 LTITAIVISPVIYWSWDTVKET   38 (84)
T ss_pred             heeEEEEecceEEEEehhcccc
Confidence            3466777889999999975433


No 34 
>KOG2034|consensus
Probab=25.38  E-value=28  Score=34.50  Aligned_cols=27  Identities=11%  Similarity=0.102  Sum_probs=20.3

Q ss_pred             CCCceecccccccccccccccccCCCCCCCCCCeeEEEecccccc
Q psy16592         86 DMETCAICRNHLMDECILCQARDAQDEPPPNGCTVAWAFSLKSSS  130 (132)
Q Consensus        86 ~~D~CAICRn~f~d~CpeCQan~~~~~~pgddCpVvwG~CgHsFH  130 (132)
                      ..|.|+||..+|-.-                  |-..-.|||.||
T Consensus       816 p~d~C~~C~~~ll~~------------------pF~vf~CgH~FH  842 (911)
T KOG2034|consen  816 PQDSCDHCGRPLLIK------------------PFYVFPCGHCFH  842 (911)
T ss_pred             CccchHHhcchhhcC------------------cceeeeccchHH
Confidence            468999998877543                  235568999999


No 35 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=25.34  E-value=24  Score=26.66  Aligned_cols=20  Identities=35%  Similarity=0.893  Sum_probs=16.4

Q ss_pred             Cceecccccc-------cccccccccc
Q psy16592         88 ETCAICRNHL-------MDECILCQAR  107 (132)
Q Consensus        88 D~CAICRn~f-------~d~CpeCQan  107 (132)
                      -.||.||+.|       -+.||.||+.
T Consensus        63 iiCGvC~~~LT~~EY~~~~~Cp~C~sp   89 (105)
T COG4357          63 IICGVCRKLLTRAEYGMCGSCPYCQSP   89 (105)
T ss_pred             EEhhhhhhhhhHHHHhhcCCCCCcCCC
Confidence            5799999987       3679999984


No 36 
>TIGR02116 toxin_Txe_YoeB toxin-antitoxin system, toxin component, Txe/YoeB family. The Axe-Txe pair in Enterococcus faecium and the homologous YefM-YoeB pair in Escherichia coli have been shown to act as an antitoxin-toxin pair. This model describes the toxin component. Nearly every example found is next to an identifiable antitoxin, as indicated by matches to TIGR01552 and/or pfam02604.
Probab=22.82  E-value=2.4e+02  Score=18.71  Aligned_cols=50  Identities=16%  Similarity=0.124  Sum_probs=27.1

Q ss_pred             HHHHHHHHHHHhHhhhhhhccccccccCCCCCCCcccEEEE-EEEEEEEeEEe
Q psy16592         33 IQELINEELQKMKEDRELNRTYKKVLDLRSEYPDVPRFTVR-KFNAVALWSWD   84 (132)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RfkIK-kWnAVA~WsWD   84 (132)
                      +++.|.+-|+.+.++  |..........+......-++.|. .|..|....++
T Consensus        19 ~~~~i~~~i~~l~~~--P~~~~~~~~~L~G~~~g~~r~rig~dyRIIY~i~~~   69 (80)
T TIGR02116        19 LKKKINELIKDVRRD--PFKGKGKPEPLKGDLSGYWSRRITDEHRLVYRVTDD   69 (80)
T ss_pred             HHHHHHHHHHHHHcC--CCCCCCCcccCCCCCCCcEEEEcCCCeEEEEEEECC
Confidence            566666666666544  322111222223333334588888 88888876554


No 37 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=22.42  E-value=32  Score=23.93  Aligned_cols=12  Identities=8%  Similarity=-0.219  Sum_probs=4.3

Q ss_pred             eeEEEecccccc
Q psy16592        119 TVAWAFSLKSSS  130 (132)
Q Consensus       119 pVvwG~CgHsFH  130 (132)
                      |+-.|.|.|.|=
T Consensus        20 pv~l~~CeH~fC   31 (65)
T PF14835_consen   20 PVCLGGCEHIFC   31 (65)
T ss_dssp             -B---SSS--B-
T ss_pred             CceeccCccHHH
Confidence            556799999983


No 38 
>PF10550 Toxin_36:  Conantokin-G mollusc-toxin;  InterPro: IPR005918 The conantokins are a family of neuroactive peptides found in the venoms of fish-hunting cone snails. They possess a relatively high number of residues (4-5) of the non-standard amino acid gamma-carboxyglutamic acid (Gla), which is generated by the post-translational modification of glutamate (Glu) residues. Conantokins are the only naturally produced peptides known to be N-methyl-D-aspartate (NMDA) receptor antagonists and show therapeutic promise in treating conditions associated with NMDA receptor dysfunction. In animal models they have exhibited anticonvulsant and anti-Parkinsonian properties and have provided neuroprotection within therapeutically acceptable times following transient focal brain ischemia [, , , ]. Upon binding of Ca2+ to Gla, conantokin undergoes a conformational transition from a distorted curvilinear 3(10) helix to a linear alpha-helix. The binding of Ca2+ to conantokin leads to the exposure of a hydrophobic region on the opposite face of the helix []. Conantokins share relatively few sequence elements, which include include sequence identity at the first four residues, homologous positioning of the two most C-terminal Gla residues, and an Arg preceding the most C-terminal Gla []. The conantokin family is currently known to include:  Conotoxin G from Conus geographus (Geography cone) (Nubecula geographus). Conantokin-L from Conus lynceus (Lynceus cone). Conantokin-R from Conus radiatus (Rayed cone). Conantokin-T from Conus tulipa (Fish-hunting cone snail) (Tulip cone). ; PDB: 1ONT_A.
Probab=20.60  E-value=83  Score=16.29  Aligned_cols=11  Identities=36%  Similarity=0.525  Sum_probs=8.2

Q ss_pred             HHHHHHhHhhh
Q psy16592         38 NEELQKMKEDR   48 (132)
Q Consensus        38 ~~~~~~~~~~~   48 (132)
                      .||.|||.+..
T Consensus         2 eee~~km~~~l   12 (15)
T PF10550_consen    2 EEEVAKMAAEL   12 (15)
T ss_dssp             HHHHHHHHHHH
T ss_pred             hHHHHHHHHHH
Confidence            47899997753


No 39 
>KOG0320|consensus
Probab=20.19  E-value=39  Score=27.84  Aligned_cols=9  Identities=0%  Similarity=-0.492  Sum_probs=6.8

Q ss_pred             EEEeccccc
Q psy16592        121 AWAFSLKSS  129 (132)
Q Consensus       121 vwG~CgHsF  129 (132)
                      +--+|||.|
T Consensus       147 vsTkCGHvF  155 (187)
T KOG0320|consen  147 VSTKCGHVF  155 (187)
T ss_pred             cccccchhH
Confidence            556888888


No 40 
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=20.13  E-value=32  Score=20.96  Aligned_cols=11  Identities=27%  Similarity=0.951  Sum_probs=5.6

Q ss_pred             CCCceeccccc
Q psy16592         86 DMETCAICRNH   96 (132)
Q Consensus        86 ~~D~CAICRn~   96 (132)
                      ..+.|.||.++
T Consensus        28 e~~~C~IC~d~   38 (41)
T PF02132_consen   28 EEDPCEICSDP   38 (41)
T ss_dssp             SSSS-HHHH-T
T ss_pred             CCCcCcCCCCC
Confidence            35677777654


No 41 
>cd00049 MH1 MH1 is a small DNA binding domain, binding in an unusal way involving a beta hairpin structure binding to the major groove. MH1 is present in Smad proteins, an important family of proteins involved in TGF-beta signalling and frequent targets of tumorigenic mutations. Also known as Domain A in dwarfin family proteins.
Probab=20.10  E-value=1.6e+02  Score=22.35  Aligned_cols=13  Identities=23%  Similarity=0.777  Sum_probs=9.0

Q ss_pred             EEEEEEeEE-ecCC
Q psy16592         75 FNAVALWSW-DMDM   87 (132)
Q Consensus        75 WnAVA~WsW-Di~~   87 (132)
                      .-+--+|+| |+..
T Consensus        75 v~~crlwRWpDL~~   88 (121)
T cd00049          75 VIYCRVWRWPDLRS   88 (121)
T ss_pred             eEEEeeeeccccCc
Confidence            345668999 7764


Done!