Query         psy16599
Match_columns 73
No_of_seqs    104 out of 175
Neff          3.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:02:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16599.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16599hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01249 Ribosomal_S21e:  Ribos 100.0   6E-49 1.3E-53  253.1   4.2   71    1-72     11-81  (81)
  2 KOG3486|consensus              100.0 1.4E-43 3.1E-48  229.2   2.4   73    1-73     11-83  (83)
  3 PF06079 Apyrase:  Apyrase;  In  86.0    0.28 6.1E-06   38.0   0.5   33    2-34    186-233 (291)
  4 PTZ00486 apyrase Superfamily;   62.4       4 8.7E-05   32.5   1.1   33    2-34    249-295 (352)
  5 PF09765 WD-3:  WD-repeat regio  59.2     8.2 0.00018   29.4   2.3   45    8-62    214-258 (291)
  6 PLN00037 photosystem II oxygen  50.4      16 0.00034   29.0   2.6   26   19-44    263-288 (313)
  7 PF01716 MSP:  Manganese-stabil  48.4      19 0.00041   27.6   2.7   27   20-46    196-222 (245)
  8 cd05759 Ig2_KIRREL3-like Secon  47.5      11 0.00023   21.9   1.0   21    6-26     62-82  (82)
  9 PF10114 PocR:  Sensory domain   45.3      27 0.00059   23.0   2.8   32   37-68     94-127 (173)
 10 cd04977 Ig1_NCAM-1_like First   44.4      13 0.00028   22.5   1.1   20    6-26     73-92  (92)
 11 cd04978 Ig4_L1-NrCAM_like Four  43.3      11 0.00025   21.0   0.7   19    6-26     57-75  (76)
 12 PRK00042 tpiA triosephosphate   41.2      43 0.00093   24.9   3.6   50   21-70     57-122 (250)
 13 cd05773 Ig8_hNephrin_like Eigh  40.2      16 0.00034   23.0   1.0   21    6-28     86-106 (109)
 14 PRK14567 triosephosphate isome  37.8      35 0.00076   25.7   2.7   48   22-69     57-120 (253)
 15 TIGR00419 tim triosephosphate   37.4      44 0.00096   24.2   3.1   47   22-70     53-113 (205)
 16 cd00311 TIM Triosephosphate is  36.4      61  0.0013   23.9   3.8   51   20-70     54-120 (242)
 17 cd05854 Ig6_Contactin-2 Sixth   34.0      22 0.00048   21.2   0.9   19    6-26     63-81  (85)
 18 cd04970 Ig6_Contactin_like Six  33.6      23 0.00049   20.6   0.9   20    6-27     63-82  (85)
 19 PRK04016 DNA-directed RNA poly  31.9      19 0.00041   22.3   0.4   17    1-17      1-17  (62)
 20 cd05723 Ig4_Neogenin Fourth im  31.8      19  0.0004   20.5   0.3   18    6-25     53-70  (71)
 21 PRK14565 triosephosphate isome  31.3      74  0.0016   23.7   3.5   50   21-70     56-121 (237)
 22 cd05861 Ig1_PDGFR-alphabeta Fr  29.7      27 0.00058   20.7   0.8   22    6-27     62-83  (84)
 23 PLN02561 triosephosphate isome  29.6      54  0.0012   24.6   2.6   49   22-70     60-124 (253)
 24 cd05763 Ig_1 Subgroup of the i  29.5      25 0.00054   19.9   0.6   19    6-26     56-74  (75)
 25 PRK14890 putative Zn-ribbon RN  27.3      45 0.00098   20.5   1.5   19    2-20      5-23  (59)
 26 PTZ00333 triosephosphate isome  27.3      94   0.002   23.2   3.5   50   21-70     60-125 (255)
 27 TIGR02892 spore_yabP sporulati  26.2      91   0.002   19.9   2.8   40   24-63     43-84  (85)
 28 cd05730 Ig3_NCAM-1_like Third   25.9      35 0.00076   20.1   0.9   19    6-26     74-92  (95)
 29 cd05876 Ig3_L1-CAM Third immun  25.5      35 0.00075   19.3   0.7   19    6-26     52-70  (71)
 30 PF10500 SR-25:  Nuclear RNA-sp  25.5      34 0.00074   25.9   0.9   38   27-68    174-215 (225)
 31 PHA02579 7 baseplate wedge sub  25.1      36 0.00079   30.6   1.1   39   19-57    271-312 (1030)
 32 cd05725 Ig3_Robo Third immunog  24.9      34 0.00073   19.0   0.6   18    6-25     51-68  (69)
 33 PRK02289 4-oxalocrotonate taut  24.2      58  0.0012   18.5   1.5   26   17-51     34-59  (60)
 34 cd05743 Ig_Perlecan_D2_like Im  22.9      33 0.00071   19.7   0.3   20    6-25     58-77  (78)
 35 PF08435 Calici_coat_C:  Calici  22.8      54  0.0012   24.7   1.5   25   20-44    158-185 (230)
 36 cd05858 Ig3_FGFR-2 Third immun  22.6      53  0.0012   19.3   1.2   19    6-26     71-89  (90)
 37 PF01194 RNA_pol_N:  RNA polyme  22.5      37  0.0008   20.8   0.5   17    1-17      1-17  (60)
 38 TIGR00223 panD L-aspartate-alp  22.2      93   0.002   21.7   2.5   21   23-48     43-63  (126)
 39 PLN02429 triosephosphate isome  21.8 1.3E+02  0.0029   23.5   3.5   49   22-70    119-183 (315)
 40 PF10929 DUF2811:  Protein of u  21.5      38 0.00082   20.7   0.4   20   44-63     33-52  (57)
 41 PF07887 Calmodulin_bind:  Calm  21.3      87  0.0019   24.5   2.4   44    9-54     15-63  (299)
 42 PF09000 Cytotoxic:  Cytotoxic;  21.3      64  0.0014   21.1   1.5   14   25-38     62-75  (85)
 43 cd05746 Ig4_Peroxidasin Fourth  21.0      41 0.00089   18.8   0.5   17    6-24     52-68  (69)
 44 COG2888 Predicted Zn-ribbon RN  20.9      64  0.0014   20.1   1.3   20    3-22      8-27  (61)
 45 PRK05449 aspartate alpha-decar  20.7   1E+02  0.0022   21.5   2.4   21   23-48     43-63  (126)
 46 PF07976 Phe_hydrox_dim:  Pheno  20.5      76  0.0016   21.8   1.8   27   36-63     58-84  (169)
 47 PF14858 DUF4486:  Domain of un  20.1      34 0.00073   28.9  -0.1   29   35-63    147-175 (542)

No 1  
>PF01249 Ribosomal_S21e:  Ribosomal protein S21e ;  InterPro: IPR001931 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. These proteins have 82 to 87 amino acids. The amino termini are all N alpha-acetylated. The N-terminal halves of the protein molecules are highly conserved in contrast to the carboxy-terminal parts [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3U5G_V 3U5C_V 3IZB_T 2XZN_Z 2XZM_Z 3IZ6_T.
Probab=100.00  E-value=6e-49  Score=253.10  Aligned_cols=71  Identities=62%  Similarity=0.949  Sum_probs=66.6

Q ss_pred             CcccccccccCCccccCCcceeeeeeeeecCCCceeecCeeEEEEehhhhhcccchHHHHHHHHHcCccccC
Q psy16599          1 MVSLTRSSASNRIIAAKDHASIQIAIADVDPATGRTTDNLKMYAICGQIRRMGESDDCIGRLAKDDGIIAKN   72 (73)
Q Consensus         1 ~~iPRKCSaTnRiI~AkDHaSVQInva~vd~~~G~~tg~~~tyai~G~iR~~GesD~~lnrL~~~~g~~~~~   72 (73)
                      +|||||||||||||+|||||||||||++||| +|+|||+++||||||+||+|||||+||||||+++|++++|
T Consensus        11 lYiPRKCS~TnriI~aKDHaSvQinv~~vd~-~G~~~g~~~t~ai~G~iR~~GesD~~l~rL~~~~g~l~~~   81 (81)
T PF01249_consen   11 LYIPRKCSATNRIISAKDHASVQINVADVDE-NGRFTGQFKTYAICGFIRRMGESDDALNRLAKKDGLLSKN   81 (81)
T ss_dssp             SSHHHCHTTTHHCHHTTSTTSEEEEEEEE-S-SS-EEEEEEEEEEHHHHHHTTHHHHHHHHHHHHTCCCSS-
T ss_pred             EeccccccccCCccccCCceeEEEEeeeecC-cccCcCCceEEEEechHhhCcchhHHHHHHHHHhCcccCC
Confidence            5999999999999999999999999999997 5999999999999999999999999999999999999986


No 2  
>KOG3486|consensus
Probab=100.00  E-value=1.4e-43  Score=229.20  Aligned_cols=73  Identities=49%  Similarity=0.786  Sum_probs=69.8

Q ss_pred             CcccccccccCCccccCCcceeeeeeeeecCCCceeecCeeEEEEehhhhhcccchHHHHHHHHHcCccccCC
Q psy16599          1 MVSLTRSSASNRIIAAKDHASIQIAIADVDPATGRTTDNLKMYAICGQIRRMGESDDCIGRLAKDDGIIAKNY   73 (73)
Q Consensus         1 ~~iPRKCSaTnRiI~AkDHaSVQInva~vd~~~G~~tg~~~tyai~G~iR~~GesD~~lnrL~~~~g~~~~~~   73 (73)
                      +|||||||+|||||.||||||||||+++||++-|.|+|+++||||||+||+|||||++++||+++||++++++
T Consensus        11 LYvPrKcS~sNriI~aKDHaSVQ~N~~~vd~~g~~~~g~~ttyAlcg~vr~~gesd~~~~rl~~~~~~~~~~~   83 (83)
T KOG3486|consen   11 LYVPRKCSATNRIITAKDHASVQLNIGHVDAEGGLYTGQFTTYALCGFVRRMGESDSGVDRLAQKDGVEAKQW   83 (83)
T ss_pred             EEecccccccceeeecccchheeecccccccccCccCCceehHHHHHHHHHcCCCcchHHHHHHhcccccccC
Confidence            5999999999999999999999999999998757799999999999999999999999999999999998875


No 3  
>PF06079 Apyrase:  Apyrase;  InterPro: IPR009283 This family consists of several eukaryotic apyrase (or adenosine diphosphatase) proteins (3.6.1.5 from EC), and related nucleoside diphosphatases (3.6.1.6 from EC). The salivary apyrases of blood-feeding arthropods are nucleotide hydrolysing enzymes implicated in the inhibition of host platelet aggregation through the hydrolysis of extracellular adenosine diphosphate [].; GO: 0005509 calcium ion binding, 0016462 pyrophosphatase activity; PDB: 2H2N_A 1S18_A 2H2U_A 1S1D_B.
Probab=86.00  E-value=0.28  Score=38.02  Aligned_cols=33  Identities=33%  Similarity=0.573  Sum_probs=18.4

Q ss_pred             ccccccc------------ccCCcccc-CCcceeeee-ee-eecCCCc
Q psy16599          2 VSLTRSS------------ASNRIIAA-KDHASIQIA-IA-DVDPATG   34 (73)
Q Consensus         2 ~iPRKCS------------aTnRiI~A-kDHaSVQIn-va-~vd~~~G   34 (73)
                      ++||+||            .||-||.| .|..+|+.. |+ .++|..|
T Consensus       186 FLPRr~S~e~Y~e~~DE~~G~N~li~a~edF~~i~v~~ig~~~~p~~G  233 (291)
T PF06079_consen  186 FLPRRCSKEPYDETADERRGCNLLISADEDFSDIKVIRIGEQLDPTRG  233 (291)
T ss_dssp             E--SEEESS---HHHHTT-B--EEEEE-TTSSSEEEEE-S----TTEE
T ss_pred             EeccccccccccchhhhhcCccEEEEeccCcceeEEEEeCCccCcccc
Confidence            5899999            68999988 566777643 66 7888555


No 4  
>PTZ00486 apyrase Superfamily; Provisional
Probab=62.43  E-value=4  Score=32.55  Aligned_cols=33  Identities=27%  Similarity=0.344  Sum_probs=21.7

Q ss_pred             cccccccc------------cCCccccCCc-ceeee-eeeeecCCCc
Q psy16599          2 VSLTRSSA------------SNRIIAAKDH-ASIQI-AIADVDPATG   34 (73)
Q Consensus         2 ~iPRKCSa------------TnRiI~AkDH-aSVQI-nva~vd~~~G   34 (73)
                      ++|||||-            +|-||.|.+| ..|+. .++..+|..|
T Consensus       249 FlPRr~S~e~Yde~~DE~~G~N~ii~~de~F~~i~vi~i~~~~p~~G  295 (352)
T PTZ00486        249 FLPRRVSNEPYDEEKDEYRGSNYIIICDEDFQNPRVIKDPQYDPERG  295 (352)
T ss_pred             EeccccCcccccchhhhhcCCcEEEEecccccceEEEecCCCCCCcc
Confidence            58999994            7889886644 44542 3556666444


No 5  
>PF09765 WD-3:  WD-repeat region;  InterPro: IPR019162 This entry represents a region of approximately 100 residues containing three WD repeats and six cysteine residues- possibly as three cysteine-bridges associated with FancL. FancL is the ubiquitin ligase protein that mediates ubiquitination of FancD2, a key step in the DNA damage pathway [, ]. FancL belongs to the multisubunit Fanconi anemia (FA) complex, which is composed of subunits: FancA, FancB, FancC, FancE, FancF, FancG, FancL/PHF9 and FancM. The WD repeats are required for interaction of FancL with other subunits of the FA complex []. In humans defects in FancL are a cause of Fanconi anemia (FA) [MIM:227650], and the FA complex is not found in FA patients. FA is a genetically heterogeneous, autosomal recessive disorder characterised by progressive pancytopenia, a diverse assortment of congenital malformations, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage), and defective DNA repair.; PDB: 3ZQS_B 3K1L_A.
Probab=59.21  E-value=8.2  Score=29.43  Aligned_cols=45  Identities=27%  Similarity=0.420  Sum_probs=32.4

Q ss_pred             cccCCccccCCcceeeeeeeeecCCCceeecCeeEEEEehhhhhcccchHHHHHH
Q psy16599          8 SASNRIIAAKDHASIQIAIADVDPATGRTTDNLKMYAICGQIRRMGESDDCIGRL   62 (73)
Q Consensus         8 SaTnRiI~AkDHaSVQInva~vd~~~G~~tg~~~tyai~G~iR~~GesD~~lnrL   62 (73)
                      +.|-|-|+-.+|.||||.|   ||...++-.+.....+.|.       |..++.|
T Consensus       214 ~~~~RrI~l~~~~sl~i~v---dP~~P~~~p~~~~l~f~G~-------~~~v~~l  258 (291)
T PF09765_consen  214 SDTYRRIALGNNVSLKIEV---DPRHPRMLPECRFLGFIGP-------DHEVNPL  258 (291)
T ss_dssp             T--EEEEEEETTEEEEEEE----TTSTTSTTCCEEECEESS-------HHHHHHH
T ss_pred             cccEEEEEECCceEEEEEE---cCCCCccCcccccccccCC-------HHHHHHH
Confidence            3467999999999999987   6666676666667777776       6666665


No 6  
>PLN00037 photosystem II oxygen-evolving enhancer protein 1; Provisional
Probab=50.41  E-value=16  Score=28.99  Aligned_cols=26  Identities=19%  Similarity=0.413  Sum_probs=21.8

Q ss_pred             cceeeeeeeeecCCCceeecCeeEEE
Q psy16599         19 HASIQIAIADVDPATGRTTDNLKMYA   44 (73)
Q Consensus        19 HaSVQInva~vd~~~G~~tg~~~tya   44 (73)
                      ..++.+.|++||++||.+-|-|..--
T Consensus       263 ~G~i~l~V~kVd~~TGEiaGvF~s~Q  288 (313)
T PLN00037        263 TGNITLSVAKSNPETGEIAGVFESIQ  288 (313)
T ss_pred             cceEEEEEEeecCCCCeEEEEEEeeC
Confidence            46788999999999999999876543


No 7  
>PF01716 MSP:  Manganese-stabilising protein / photosystem II polypeptide;  InterPro: IPR002628 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII OEC protein PsbO, which appears to be the most important extrinsic protein for oxygen evolution. PsbO lies closest to the Mn cluster where water oxidation occurs, and has a stabilising effect on the Mn cluster. As a result, PsbO is often referred to as the Mn-stabilising protein (MSP), although none of its amino acids are likely ligands for Mn. Calcium ions were found to modify the conformation of PsbO in solution [].; GO: 0005509 calcium ion binding, 0015979 photosynthesis, 0042549 photosystem II stabilization, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 3PRR_O 4FBY_f 3BZ1_O 3KZI_O 1S5L_o 2AXT_o 3BZ2_O 3PRQ_O 3ARC_O 3A0B_O ....
Probab=48.36  E-value=19  Score=27.63  Aligned_cols=27  Identities=30%  Similarity=0.474  Sum_probs=22.2

Q ss_pred             ceeeeeeeeecCCCceeecCeeEEEEe
Q psy16599         20 ASIQIAIADVDPATGRTTDNLKMYAIC   46 (73)
Q Consensus        20 aSVQInva~vd~~~G~~tg~~~tyai~   46 (73)
                      .+|-+.|++||++||.+-|-|..--.+
T Consensus       196 G~i~l~V~kVd~~TGEiaGvF~s~QpS  222 (245)
T PF01716_consen  196 GSISLSVAKVDPETGEIAGVFESIQPS  222 (245)
T ss_dssp             EEEEEEEEEEETTTTEEEEEEEEEEEB
T ss_pred             ceEEEEEEeECCCcCcEEEEEEeeCCC
Confidence            467889999999999999988765544


No 8  
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=47.51  E-value=11  Score=21.92  Aligned_cols=21  Identities=14%  Similarity=0.324  Sum_probs=16.1

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      .|.++|.-+..-=++|++++|
T Consensus        62 ~C~a~n~~l~~~~~~s~~l~v   82 (82)
T cd05759          62 TCRARNEALPTGKETSVTLDV   82 (82)
T ss_pred             EEEEcCccCCCCcEEEEEEcC
Confidence            588888777776788888875


No 9  
>PF10114 PocR:  Sensory domain found in PocR;  InterPro: IPR018771 This entry is thought to act as a sensory domain in histidine kinases catalysing the reaction: ATP + protein L-histidine = ADP + protein N- phospho-L-histidine. 
Probab=45.30  E-value=27  Score=23.00  Aligned_cols=32  Identities=38%  Similarity=0.551  Sum_probs=25.4

Q ss_pred             ecCeeEEEEehhhhhcccchHH--HHHHHHHcCc
Q psy16599         37 TDNLKMYAICGQIRRMGESDDC--IGRLAKDDGI   68 (73)
Q Consensus        37 tg~~~tyai~G~iR~~GesD~~--lnrL~~~~g~   68 (73)
                      .|+.--|.++|.++-....++.  +.+++++.|+
T Consensus        94 ~g~~iG~i~~G~v~~~~~~~~~~~~~~~a~~~~~  127 (173)
T PF10114_consen   94 DGEYIGYIICGQVLLEDPDDESELIRELAKKYGI  127 (173)
T ss_pred             CCEEEEEEEEEEeecCCCchhHHHHHHHHHHcCC
Confidence            3455558899999999888887  8888887765


No 10 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=44.42  E-value=13  Score=22.47  Aligned_cols=20  Identities=15%  Similarity=0.293  Sum_probs=14.5

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      +|.|+|..-. +..+||++.|
T Consensus        73 ~C~A~N~~g~-~~~~sv~l~~   92 (92)
T cd04977          73 KCVATDAKGT-ESEATVNLKI   92 (92)
T ss_pred             EEEEEcCCCC-cceeEEEEEC
Confidence            6999997644 5677887764


No 11 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=43.25  E-value=11  Score=21.04  Aligned_cols=19  Identities=21%  Similarity=0.106  Sum_probs=12.3

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      .|.|+|.  ...+.++++++|
T Consensus        57 ~C~A~N~--~G~~~~~~~l~V   75 (76)
T cd04978          57 QCNASNV--HGYLLANAFVHV   75 (76)
T ss_pred             EEEEEcc--CCeEEEeEEEEE
Confidence            5777777  344566777665


No 12 
>PRK00042 tpiA triosephosphate isomerase; Provisional
Probab=41.20  E-value=43  Score=24.89  Aligned_cols=50  Identities=28%  Similarity=0.555  Sum_probs=35.1

Q ss_pred             eeeeeeeeecCC-CceeecCe---------eEEEEehhhhhc---ccchHHHHH---HHHHcCccc
Q psy16599         21 SIQIAIADVDPA-TGRTTDNL---------KMYAICGQIRRM---GESDDCIGR---LAKDDGIIA   70 (73)
Q Consensus        21 SVQInva~vd~~-~G~~tg~~---------~tyai~G~iR~~---GesD~~lnr---L~~~~g~~~   70 (73)
                      .+++---++++. .|.|||+.         -.|.|-|-=-|+   ||+|+.+++   .|.+.||.+
T Consensus        57 ~i~vgAQn~~~~~~Ga~TGevS~~mLkd~G~~~viiGHSERR~~f~Etd~~v~~K~~~a~~~gl~p  122 (250)
T PRK00042         57 NIKLGAQNVHPEDSGAFTGEISAEMLKDLGVKYVIIGHSERRQYFGETDELVNKKVKAALKAGLTP  122 (250)
T ss_pred             CeEEEecccccccCCCccCccCHHHHHHCCCCEEEeCcccccCccCcCHHHHHHHHHHHHHCCCEE
Confidence            455555566653 49999987         467777754443   999999998   557777653


No 13 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=40.20  E-value=16  Score=22.95  Aligned_cols=21  Identities=24%  Similarity=0.389  Sum_probs=16.0

Q ss_pred             cccccCCccccCCcceeeeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAIAD   28 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInva~   28 (73)
                      .|.|+|.+  ..|.+++|+.+..
T Consensus        86 ~C~A~N~~--G~~~~~i~L~~~~  106 (109)
T cd05773          86 TCTAHNSL--GEDSLDIQLVSTS  106 (109)
T ss_pred             EEEEEeCC--ccCcEEEEEEecC
Confidence            68899987  5578888887753


No 14 
>PRK14567 triosephosphate isomerase; Provisional
Probab=37.81  E-value=35  Score=25.66  Aligned_cols=48  Identities=21%  Similarity=0.313  Sum_probs=31.5

Q ss_pred             eeeeeeeecC-CCceeecCe---------eEEEEehhhhhc---ccchHHHHH---HHHHcCcc
Q psy16599         22 IQIAIADVDP-ATGRTTDNL---------KMYAICGQIRRM---GESDDCIGR---LAKDDGII   69 (73)
Q Consensus        22 VQInva~vd~-~~G~~tg~~---------~tyai~G~iR~~---GesD~~lnr---L~~~~g~~   69 (73)
                      +.+---++++ ..|.|||+.         -.|+|-|-=-|+   ||+|+-+++   -|.+.||.
T Consensus        57 i~vgAQnv~~~~~Ga~TGEvS~~mLkd~G~~yviiGHSERR~~f~Etd~~v~~Kv~~al~~gl~  120 (253)
T PRK14567         57 VGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT  120 (253)
T ss_pred             CEEEccccccccCCCccCcCCHHHHHHcCCCEEEECcccccCccCCCHHHHHHHHHHHHHCCCE
Confidence            3333334443 259999986         467777755444   999999988   45667764


No 15 
>TIGR00419 tim triosephosphate isomerase. Triosephosphate isomerase (tim/TPIA) is the glycolytic enzyme that catalyzes the reversible interconversion of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. The active site of the enzyme is located between residues 240-258 of the model ([AV]-Y-E-P-[LIVM]-W-[SA]-I-G-T-[GK]) with E being the active site residue. There is a slight deviation from this sequence within the archeal members of this family.
Probab=37.44  E-value=44  Score=24.19  Aligned_cols=47  Identities=26%  Similarity=0.369  Sum_probs=30.3

Q ss_pred             eeeeeeeecCC-CceeecCee---------EEEEehh-hhhcccchHHHHH---HHHHcCccc
Q psy16599         22 IQIAIADVDPA-TGRTTDNLK---------MYAICGQ-IRRMGESDDCIGR---LAKDDGIIA   70 (73)
Q Consensus        22 VQInva~vd~~-~G~~tg~~~---------tyai~G~-iR~~GesD~~lnr---L~~~~g~~~   70 (73)
                      +.+---+++++ .|.|||+..         .|.|-|- =||.||+|  +++   .|.+.||.+
T Consensus        53 i~vgAQn~~~~~~Ga~TGevS~~mLkd~G~~~viiGHSERRf~Etd--i~~Kv~~a~~~gl~~  113 (205)
T TIGR00419        53 IPVYAQHVDAVLSGAHTGEISAEMLKDIGAKGTLINHSERRMKLAD--IEKKIARLKELGLTS  113 (205)
T ss_pred             ceEEecccccccCCCccCcCCHHHHHHcCCCEEEECcccCCCCccH--HHHHHHHHHHCCCEE
Confidence            44444455653 499999974         6776663 35589999  776   446666643


No 16 
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate. The reaction is very efficient and requires neither cofactors nor metal ions. TIM, usually homodimeric, but in some organisms tetrameric, is ubiqitous and conserved in function across eukaryotes, bacteria and archaea.
Probab=36.38  E-value=61  Score=23.92  Aligned_cols=51  Identities=27%  Similarity=0.552  Sum_probs=35.1

Q ss_pred             ceeeeeeeeecCCC-ceeecCe---------eEEEEehhhhhc---ccchHHHHH---HHHHcCccc
Q psy16599         20 ASIQIAIADVDPAT-GRTTDNL---------KMYAICGQIRRM---GESDDCIGR---LAKDDGIIA   70 (73)
Q Consensus        20 aSVQInva~vd~~~-G~~tg~~---------~tyai~G~iR~~---GesD~~lnr---L~~~~g~~~   70 (73)
                      +.+.+---++++.. |.|||+.         -.|.|-|-=-|+   ||+|+-+++   .|.+.||.+
T Consensus        54 ~~i~vgAQnv~~~~~Ga~TGevS~~mL~d~G~~~viiGHSERR~~f~Et~~~i~~Kv~~a~~~gl~p  120 (242)
T cd00311          54 SKIKVGAQNVSPEDSGAFTGEISAEMLKDAGAKYVIIGHSERRQYFGETDEDVAKKVKAALEAGLTP  120 (242)
T ss_pred             CCeEEEecccccccCCCCcCcCCHHHHHHcCCCEEEeCcccccCcCCCCcHHHHHHHHHHHHCCCEE
Confidence            34555555566543 9999987         467777765555   899999998   446677653


No 17 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=33.98  E-value=22  Score=21.22  Aligned_cols=19  Identities=16%  Similarity=0.260  Sum_probs=14.0

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      +|.|+|.+  ..+.++.++.|
T Consensus        63 tC~A~n~~--g~~~~~~~L~V   81 (85)
T cd05854          63 TCTAQTVV--DSASASATLVV   81 (85)
T ss_pred             EEEEecCC--CCEEEEEEEEE
Confidence            69999966  56667777766


No 18 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=33.64  E-value=23  Score=20.63  Aligned_cols=20  Identities=15%  Similarity=0.175  Sum_probs=14.1

Q ss_pred             cccccCCccccCCcceeeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAIA   27 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInva   27 (73)
                      +|.++|.+  ..+.++.+|.|.
T Consensus        63 ~C~a~n~~--g~~~~~~~l~V~   82 (85)
T cd04970          63 TCTAQTVV--DSLSASADLIVR   82 (85)
T ss_pred             EEEEecCC--CcEEEEEEEEEE
Confidence            69999966  345677777764


No 19 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=31.85  E-value=19  Score=22.31  Aligned_cols=17  Identities=29%  Similarity=0.399  Sum_probs=14.8

Q ss_pred             CcccccccccCCccccC
Q psy16599          1 MVSLTRSSASNRIIAAK   17 (73)
Q Consensus         1 ~~iPRKCSaTnRiI~Ak   17 (73)
                      |.||=.|..-+++|+.+
T Consensus         1 MiiPvRCFTCGkvi~~~   17 (62)
T PRK04016          1 MMIPVRCFTCGKVIAEK   17 (62)
T ss_pred             CCCCeEecCCCCChHHH
Confidence            78999999999999863


No 20 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=31.79  E-value=19  Score=20.50  Aligned_cols=18  Identities=28%  Similarity=0.318  Sum_probs=9.6

Q ss_pred             cccccCCccccCCcceeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIA   25 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQIn   25 (73)
                      +|.|+|.+  ....+++|+.
T Consensus        53 ~C~A~N~~--G~~~~~~~L~   70 (71)
T cd05723          53 QCIAENDV--GNVQASAQLI   70 (71)
T ss_pred             EEEEEcCC--CEEEEEEEEE
Confidence            47777765  2234455544


No 21 
>PRK14565 triosephosphate isomerase; Provisional
Probab=31.32  E-value=74  Score=23.68  Aligned_cols=50  Identities=26%  Similarity=0.373  Sum_probs=34.1

Q ss_pred             eeeeeeeeecCC-CceeecCe---------eEEEEehhhhh---cccchHHHHH---HHHHcCccc
Q psy16599         21 SIQIAIADVDPA-TGRTTDNL---------KMYAICGQIRR---MGESDDCIGR---LAKDDGIIA   70 (73)
Q Consensus        21 SVQInva~vd~~-~G~~tg~~---------~tyai~G~iR~---~GesD~~lnr---L~~~~g~~~   70 (73)
                      .+++---++++. .|.|||+.         -.|+|-|---|   .||.|+.+++   .|.+.||.+
T Consensus        56 ~i~vgAQnv~~~~~Ga~TGevS~~mLkd~G~~~viiGHSERR~~f~Etd~~V~~Kv~~al~~gl~p  121 (237)
T PRK14565         56 NIKLGAQNCFYGSSGGYTGEISAKMLKECGCSYVILGHSERRSTFHETDSDIRLKAESAIESGLIP  121 (237)
T ss_pred             CceEEecccccccCCCccCccCHHHHHHcCCCEEEECcccccCcCCcCHHHHHHHHHHHHHCCCEE
Confidence            455555566653 49999987         46887775433   3999999976   557777653


No 22 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=29.65  E-value=27  Score=20.73  Aligned_cols=22  Identities=14%  Similarity=0.225  Sum_probs=15.6

Q ss_pred             cccccCCccccCCcceeeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAIA   27 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInva   27 (73)
                      +|.++|..=...+.+||.|.|-
T Consensus        62 ~C~a~n~~~~~~~~~sv~i~V~   83 (84)
T cd05861          62 ECAAHESTQDQKAFKKVNITVH   83 (84)
T ss_pred             EEEEEECccCcceeEEEEEEEe
Confidence            5888877555567788887764


No 23 
>PLN02561 triosephosphate isomerase
Probab=29.63  E-value=54  Score=24.59  Aligned_cols=49  Identities=27%  Similarity=0.400  Sum_probs=32.9

Q ss_pred             eeeeeeeecCC-CceeecCe---------eEEEEehhhhhc---ccchHHHHH---HHHHcCccc
Q psy16599         22 IQIAIADVDPA-TGRTTDNL---------KMYAICGQIRRM---GESDDCIGR---LAKDDGIIA   70 (73)
Q Consensus        22 VQInva~vd~~-~G~~tg~~---------~tyai~G~iR~~---GesD~~lnr---L~~~~g~~~   70 (73)
                      +.+---+++++ .|.|||+.         -.|+|-|---|+   ||+|+-+++   -|.+.||.+
T Consensus        60 i~vgAQnv~~~~~Ga~TGevS~~mL~d~G~~~viiGHSERR~~f~Etd~~v~~Kv~~al~~gl~p  124 (253)
T PLN02561         60 FQVAAQNCWVKKGGAFTGEISAEMLVNLGIPWVILGHSERRALLGESNEFVGDKVAYALSQGLKV  124 (253)
T ss_pred             CeEEeccccCcCCCCccCcCCHHHHHHcCCCEEEECcccccCccCCChHHHHHHHHHHHHCcCEE
Confidence            44444456653 49999986         367777754332   999999998   456677643


No 24 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=29.45  E-value=25  Score=19.90  Aligned_cols=19  Identities=16%  Similarity=0.219  Sum_probs=10.6

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      .|.|+|..  ..+.++++++|
T Consensus        56 ~C~A~N~~--G~~~~~~~l~V   74 (75)
T cd05763          56 SCTAQNTA--GSISANATLTV   74 (75)
T ss_pred             EEEEEcCC--CEEEeeEEEEE
Confidence            47777764  23455555554


No 25 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=27.25  E-value=45  Score=20.49  Aligned_cols=19  Identities=16%  Similarity=0.274  Sum_probs=16.4

Q ss_pred             cccccccccCCccccCCcc
Q psy16599          2 VSLTRSSASNRIIAAKDHA   20 (73)
Q Consensus         2 ~iPRKCSaTnRiI~AkDHa   20 (73)
                      .-|.+|+..|+.|+..+++
T Consensus         5 ~~~~~CtSCg~~i~~~~~~   23 (59)
T PRK14890          5 MEPPKCTSCGIEIAPREKA   23 (59)
T ss_pred             ccCccccCCCCcccCCCcc
Confidence            3477999999999999986


No 26 
>PTZ00333 triosephosphate isomerase; Provisional
Probab=27.25  E-value=94  Score=23.20  Aligned_cols=50  Identities=22%  Similarity=0.471  Sum_probs=32.6

Q ss_pred             eeeeeeeeecCC-CceeecCee---------EEEEehhhhh---cccchHHHHH---HHHHcCccc
Q psy16599         21 SIQIAIADVDPA-TGRTTDNLK---------MYAICGQIRR---MGESDDCIGR---LAKDDGIIA   70 (73)
Q Consensus        21 SVQInva~vd~~-~G~~tg~~~---------tyai~G~iR~---~GesD~~lnr---L~~~~g~~~   70 (73)
                      .+.+---++++. .|.|||+..         .|+|-|-=-|   .||+|+-+++   -|.+.||.+
T Consensus        60 ~i~vgAQn~~~~~~Ga~TGevS~~mL~d~G~~~viiGHSERR~~f~Etd~~I~~Kv~~al~~gl~p  125 (255)
T PTZ00333         60 NFKISSQNVSLTGSGAFTGEISAEMLKDLGINWTILGHSERRQYFGETNEIVAQKVKNALENGLKV  125 (255)
T ss_pred             CeeEEccccccccCCCccCcCCHHHHHHcCCCEEEECcccccCcCCCCcHHHHHHHHHHHHCCCEE
Confidence            344444455554 399999874         5666664322   2999999999   456677653


No 27 
>TIGR02892 spore_yabP sporulation protein YabP. Members of this protein family are the YabP protein of the bacterial sporulation program, as found in Bacillus subtilis, Clostridium tetani, and other spore-forming members of the Firmicutes. In Bacillus subtilis, a yabP single mutant appears to sporulate and germinate normally (PubMed:11283287), but is in an operon with yabQ (essential for formation of the spore cortex), it near-universal among endospore-forming bacteria, and is found nowhere else. It is likely, therefore, that YabP does have a function in sporulation or germination, one that is either unappreciated or partially redundant with that of another protein.
Probab=26.17  E-value=91  Score=19.91  Aligned_cols=40  Identities=10%  Similarity=0.144  Sum_probs=24.0

Q ss_pred             eeeeeecCCCce--eecCeeEEEEehhhhhcccchHHHHHHH
Q psy16599         24 IAIADVDPATGR--TTDNLKMYAICGQIRRMGESDDCIGRLA   63 (73)
Q Consensus        24 Inva~vd~~~G~--~tg~~~tyai~G~iR~~GesD~~lnrL~   63 (73)
                      +.|..+|+++|.  +.|.......+-.-..++.++.-+.||+
T Consensus        43 L~I~~l~~E~Gev~I~G~I~si~Y~~~~~~~~~~~~~~~rlf   84 (85)
T TIGR02892        43 LKMNKLDVENGQVIIKGFISELTYSEGNGSKEKGKGFFSRLF   84 (85)
T ss_pred             eEeeEEeccccEEEEEEEEEEEEEcccccccccccchhHHhc
Confidence            456778877777  4777776666631122344445667665


No 28 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=25.94  E-value=35  Score=20.09  Aligned_cols=19  Identities=21%  Similarity=0.312  Sum_probs=12.6

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      .|.|+|..=  .+.+++++.|
T Consensus        74 ~C~a~N~~G--~~~~~~~L~V   92 (95)
T cd05730          74 TCIAENKAG--EQEAEIHLKV   92 (95)
T ss_pred             EEEEEcCCC--eEEEEEEEEE
Confidence            588888873  3566666654


No 29 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=25.53  E-value=35  Score=19.34  Aligned_cols=19  Identities=11%  Similarity=0.092  Sum_probs=11.1

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      .|.|+|.+=.  +-+++++.|
T Consensus        52 ~C~a~N~~G~--~~~~~~l~V   70 (71)
T cd05876          52 VCTAENSEGS--ARHHYTVTV   70 (71)
T ss_pred             EEEEEcCCCe--EEEEEEEEE
Confidence            5788887633  344555544


No 30 
>PF10500 SR-25:  Nuclear RNA-splicing-associated protein;  InterPro: IPR019532  SR-25, otherwise known as ADP-ribosylation factor-like factor 6-interacting protein 4, is expressed in virtually all tissue types. At the N terminus there is a repeat of serine-arginine (SR repeat), and towards the middle of the protein there are clusters of both serines and of basic amino acids. The presence of many nuclear localisation signals strongly implies that this is a nuclear protein that may contribute to RNA splicing []. SR-25 is also implicated, along with heat-shock-protein-27, as a mediator in the Rac1 (GTPase ras-related C3 botulinum toxin substrate 1; also see IPR019093 from INTERPRO) signalling pathway [].
Probab=25.45  E-value=34  Score=25.93  Aligned_cols=38  Identities=37%  Similarity=0.436  Sum_probs=19.8

Q ss_pred             eeecCCCceeecCeeEEEEehhhhh---cccchHHHHHHH-HHcCc
Q psy16599         27 ADVDPATGRTTDNLKMYAICGQIRR---MGESDDCIGRLA-KDDGI   68 (73)
Q Consensus        27 a~vd~~~G~~tg~~~tyai~G~iR~---~GesD~~lnrL~-~~~g~   68 (73)
                      -.|||+||++--    +-=.|.|=.   --|-+-.||..| .-||+
T Consensus       174 rVvDpETGRtRL----IkGdGEilEEIVSkERHkeINkqAT~gDG~  215 (225)
T PF10500_consen  174 RVVDPETGRTRL----IKGDGEILEEIVSKERHKEINKQATRGDGL  215 (225)
T ss_pred             eeecCCCCceee----ecccchHHHHHhhHHHHHHHHHhhcccchH
Confidence            368999998531    111122110   113456777777 44665


No 31 
>PHA02579 7 baseplate wedge subunit; Provisional
Probab=25.12  E-value=36  Score=30.62  Aligned_cols=39  Identities=23%  Similarity=0.312  Sum_probs=31.7

Q ss_pred             cceeeeeeeeecCCCce-e-ecCeeEEE-EehhhhhcccchH
Q psy16599         19 HASIQIAIADVDPATGR-T-TDNLKMYA-ICGQIRRMGESDD   57 (73)
Q Consensus        19 HaSVQInva~vd~~~G~-~-tg~~~tya-i~G~iR~~GesD~   57 (73)
                      |+|.+|.+++++-+.|. | ..-|.+|| +-|.||+..|+=.
T Consensus       271 fSsddiTFaKlg~~l~lgFdve~F~~ya~LP~~v~~~aEA~a  312 (1030)
T PHA02579        271 FSSDDITFAKLGDDLGLGFDVEIFGTYARLPGDVSRKAEAMA  312 (1030)
T ss_pred             ecccceEEEeeccccCCCceeeeecchhhCCcchhhhhhhee
Confidence            68999999999976666 3 56688898 7899999888643


No 32 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=24.88  E-value=34  Score=19.02  Aligned_cols=18  Identities=28%  Similarity=0.198  Sum_probs=10.7

Q ss_pred             cccccCCccccCCcceeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIA   25 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQIn   25 (73)
                      .|.++|.+=  .+.+++++.
T Consensus        51 ~C~a~N~~G--~~~~~~~l~   68 (69)
T cd05725          51 TCEAENMVG--KIEASASLT   68 (69)
T ss_pred             EEEEEcCCC--cEEEEEEEE
Confidence            588888653  345555554


No 33 
>PRK02289 4-oxalocrotonate tautomerase; Provisional
Probab=24.23  E-value=58  Score=18.54  Aligned_cols=26  Identities=19%  Similarity=0.355  Sum_probs=18.4

Q ss_pred             CCcceeeeeeeeecCCCceeecCeeEEEEehhhhh
Q psy16599         17 KDHASIQIAIADVDPATGRTTDNLKMYAICGQIRR   51 (73)
Q Consensus        17 kDHaSVQInva~vd~~~G~~tg~~~tyai~G~iR~   51 (73)
                      ....||.+.|.++++         ..|++.|.++.
T Consensus        34 ~p~~~v~V~i~ev~~---------~~~~~~g~~~~   59 (60)
T PRK02289         34 APKEAIHVFINDMPE---------GTYYPQGEMKT   59 (60)
T ss_pred             cCcceEEEEEEEeCh---------hheEECCEEcC
Confidence            347899999999996         34566665543


No 34 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=22.94  E-value=33  Score=19.74  Aligned_cols=20  Identities=10%  Similarity=-0.177  Sum_probs=11.3

Q ss_pred             cccccCCccccCCcceeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIA   25 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQIn   25 (73)
                      .|.++|.+=.+.-.+++++.
T Consensus        58 ~C~a~N~~G~~~~~~~~~~~   77 (78)
T cd05743          58 TCEAINTRGMVFGIPDGILT   77 (78)
T ss_pred             EEEEEecCCEEEecccEEEE
Confidence            46666665555555555554


No 35 
>PF08435 Calici_coat_C:  Calicivirus coat protein C-terminal;  InterPro: IPR013643  Bovine calicivirus is a positive-stranded ssRNA viruses that cause gastroenteritis []. The calicivirus genome contains two open reading frames, ORF1 and ORF2 [, ]. ORF1 encodes a non-structural polypeptide, which has RNA helicase, cysteine protease and RNA polymerase activity. The regions of the poly-protein in which these activities lie are similar to proteins produced by the picornaviruses [, ]. ORF2 encodes a structural protein []. This signature finds ORF2, the structural coat protein. Two different families of caliciviruses can be distinguished on the basis of sequence similarity, namely those classified as small round structured viruses (SRSVs) and those classed as non-SRSVs. Rabbit hemorrhagic disease virus (RHDV) which causes a highly contagious disease of wild and domestic rabbits belongs to the family Caliciviridae []. The capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry. It is about 38nm in diameter and consists of 180 capsid proteins. The capsid encapsulates the genomic RNA and VP2 proteins and attaches the virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells. The Shell domain (S domain) contains elements essential for the formation of the icosahedron. The Protruding domain (P domain) is divided into sub-domains P1 and P2. An hypervariable region in P2 is thought to play an important role in receptor binding and immune reactivity. This is the calicivirus coat protein (IPR004005 from INTERPRO) C-terminal region. ; PDB: 3D26_B 2ZL6_B 1IHM_B 3BY2_A 3BY1_A 2ZL7_A 2ZL5_A 3LQ6_B 3LQE_A 3SEJ_A ....
Probab=22.83  E-value=54  Score=24.66  Aligned_cols=25  Identities=36%  Similarity=0.448  Sum_probs=17.5

Q ss_pred             ceeeeeeeee---cCCCceeecCeeEEE
Q psy16599         20 ASIQIAIADV---DPATGRTTDNLKMYA   44 (73)
Q Consensus        20 aSVQInva~v---d~~~G~~tg~~~tya   44 (73)
                      |-+|=.+|.|   ||.|||..+|.|.|-
T Consensus       158 ap~q~~~ALl~YvnpdTgr~LfE~KLy~  185 (230)
T PF08435_consen  158 APSQGDVALLRYVNPDTGRVLFEAKLYP  185 (230)
T ss_dssp             -S-SSSEEEEEEEETTTTEEEEEEEEET
T ss_pred             CccccceeEEEEecCCCCCEEEEEEecC
Confidence            3445555554   999999999999873


No 36 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=22.59  E-value=53  Score=19.34  Aligned_cols=19  Identities=26%  Similarity=0.221  Sum_probs=12.2

Q ss_pred             cccccCCccccCCcceeeeee
Q psy16599          6 RSSASNRIIAAKDHASIQIAI   26 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQInv   26 (73)
                      .|.|+|.+=  .++++.+++|
T Consensus        71 ~C~A~N~~G--~~~~~a~L~V   89 (90)
T cd05858          71 TCLAGNSIG--ISHHSAWLTV   89 (90)
T ss_pred             EEEEEeCCC--cccceEEEEE
Confidence            588888663  4566666655


No 37 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=22.51  E-value=37  Score=20.84  Aligned_cols=17  Identities=24%  Similarity=0.386  Sum_probs=10.9

Q ss_pred             CcccccccccCCccccC
Q psy16599          1 MVSLTRSSASNRIIAAK   17 (73)
Q Consensus         1 ~~iPRKCSaTnRiI~Ak   17 (73)
                      |.||=.|-.-+++|+.|
T Consensus         1 MiiPVRCFTCGkvi~~~   17 (60)
T PF01194_consen    1 MIIPVRCFTCGKVIGNK   17 (60)
T ss_dssp             ---SSS-STTTSBTCGH
T ss_pred             CCCceecCCCCCChhHh
Confidence            67899999999998753


No 38 
>TIGR00223 panD L-aspartate-alpha-decarboxylase. Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group.
Probab=22.16  E-value=93  Score=21.70  Aligned_cols=21  Identities=33%  Similarity=0.803  Sum_probs=14.5

Q ss_pred             eeeeeeecCCCceeecCeeEEEEehh
Q psy16599         23 QIAIADVDPATGRTTDNLKMYAICGQ   48 (73)
Q Consensus        23 QInva~vd~~~G~~tg~~~tyai~G~   48 (73)
                      |+.|..|+  ||.   .+.||+|-|.
T Consensus        43 ~V~V~Nv~--NG~---Rf~TYvI~G~   63 (126)
T TIGR00223        43 KVDIVNVN--NGK---RFSTYAIAGK   63 (126)
T ss_pred             EEEEEECC--CCc---EEEEEEEEcC
Confidence            45566666  553   4789999886


No 39 
>PLN02429 triosephosphate isomerase
Probab=21.82  E-value=1.3e+02  Score=23.46  Aligned_cols=49  Identities=29%  Similarity=0.456  Sum_probs=33.7

Q ss_pred             eeeeeeeecCC-CceeecCee---------EEEEehhh--hh-cccchHHHHH---HHHHcCccc
Q psy16599         22 IQIAIADVDPA-TGRTTDNLK---------MYAICGQI--RR-MGESDDCIGR---LAKDDGIIA   70 (73)
Q Consensus        22 VQInva~vd~~-~G~~tg~~~---------tyai~G~i--R~-~GesD~~lnr---L~~~~g~~~   70 (73)
                      +++---++++. .|.|||+..         .|+|-|-=  |. .||.|+-+++   .|.+.||.+
T Consensus       119 i~vgAQnv~~~~~GayTGEVSa~mLkd~Gv~~ViiGHSERR~~f~Etd~~V~~Kv~~al~~GL~p  183 (315)
T PLN02429        119 IDISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDEFIGKKAAYALSEGLGV  183 (315)
T ss_pred             CeEEecccCCCCCCCccCcCCHHHHHHcCCCEEEeCccccCCCCCcCHHHHHHHHHHHHHCcCEE
Confidence            55555566653 499999974         67777743  22 3999999998   456777653


No 40 
>PF10929 DUF2811:  Protein of unknown function (DUF2811);  InterPro: IPR021231  This is a bacterial family of uncharacterised proteins. 
Probab=21.48  E-value=38  Score=20.69  Aligned_cols=20  Identities=25%  Similarity=0.411  Sum_probs=18.3

Q ss_pred             EEehhhhhcccchHHHHHHH
Q psy16599         44 AICGQIRRMGESDDCIGRLA   63 (73)
Q Consensus        44 ai~G~iR~~GesD~~lnrL~   63 (73)
                      ||+|++=+.|..|-++.|+-
T Consensus        33 ALa~FL~QnG~~~r~~~r~Y   52 (57)
T PF10929_consen   33 ALAGFLLQNGCQDRAVTRVY   52 (57)
T ss_pred             HHHHHHHHcCchhHHHHHHH
Confidence            79999999999999999875


No 41 
>PF07887 Calmodulin_bind:  Calmodulin binding protein-like;  InterPro: IPR012416 The members of this family are putative or actual calmodulin binding proteins expressed by various plant species. Some members (for example, Q8H6T7 from SWISSPROT), are known to be involved in the induction of plant defence responses []. However, their precise function in this regard is as yet unknown. 
Probab=21.31  E-value=87  Score=24.49  Aligned_cols=44  Identities=27%  Similarity=0.394  Sum_probs=30.1

Q ss_pred             ccCCccccCCcceeeeeeeeecCCCceeecC-----eeEEEEehhhhhccc
Q psy16599          9 ASNRIIAAKDHASIQIAIADVDPATGRTTDN-----LKMYAICGQIRRMGE   54 (73)
Q Consensus         9 aTnRiI~AkDHaSVQInva~vd~~~G~~tg~-----~~tyai~G~iR~~Ge   54 (73)
                      +|+.-|.|+|-+++||-+  +|..||.-+|.     ....++-|..-.-+.
T Consensus        15 fT~~~i~a~~g~~i~V~l--~d~~~~v~~g~lss~kieIvvLdGdF~~~~~   63 (299)
T PF07887_consen   15 FTGSKIEAEDGAPIKVAL--VDANTGVTSGPLSSAKIEIVVLDGDFNDEDC   63 (299)
T ss_pred             ccCCceEecCCCcEEEEE--EECCCCccCCCCCCcEEEEEEEccccCCCcc
Confidence            688889999999999877  45446654443     455677776655433


No 42 
>PF09000 Cytotoxic:  Cytotoxic;  InterPro: IPR009105 Colicins are plasmid-encoded protein antibiotics, or bacteriocins, produced by strains of Escherichia coli that kill closely related bacteria. Colicins are classified according to the cell-surface receptor they bind to, colicin E3 binding to the BtuB receptor involved in vitamin B12 uptake. The lethal action of colicin E3 arises from its ability to inactivate the ribosome by site-specific RNase cleavage of the 16S ribosomal RNA, which is carried out by the catalytic, or ribonuclease domain. Colicin E3 is comprised of three domains, each domain being involved in a different stage of infection: receptor binding, translocation and cytotoxicity. Colicin E3 is a Y-shaped molecule with the receptor-binding middle domain forming the stalk, the N-terminal translocation domain forming the two globular heads (IPR003058 from INTERPRO), and the C-terminal catalytic domain forming the two globular arms. To neutralise the toxic effects of colicin E3, the host cell produces an immunity protein, which binds to the C-terminal end of the ribonuclease domain and effectively suppresses its activity. This entry represents the ribonuclease domain (also called catalytic or cytotoxic domain) found in various colicins. This domain confers cytotoxic activity to proteins, enabling the formation of nucleolytic breaks in 16S ribosomal RNA. The structure of the domain reveals a highly twisted central beta-sheet elaborated with a short N-terminal alpha-helix [, ]. ; GO: 0003723 RNA binding, 0016788 hydrolase activity, acting on ester bonds, 0043022 ribosome binding, 0009405 pathogenesis; PDB: 2B5U_C 1JCH_A 1E44_B 2XFZ_Y.
Probab=21.28  E-value=64  Score=21.14  Aligned_cols=14  Identities=29%  Similarity=0.634  Sum_probs=9.5

Q ss_pred             eeeeecCCCceeec
Q psy16599         25 AIADVDPATGRTTD   38 (73)
Q Consensus        25 nva~vd~~~G~~tg   38 (73)
                      -++++||.||.++.
T Consensus        62 HLGe~Dp~TGe~~k   75 (85)
T PF09000_consen   62 HLGEFDPKTGEQIK   75 (85)
T ss_dssp             EEEEE-TTTS-EEE
T ss_pred             CcccccCCcccCcC
Confidence            47899999998764


No 43 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=20.97  E-value=41  Score=18.84  Aligned_cols=17  Identities=24%  Similarity=0.262  Sum_probs=9.1

Q ss_pred             cccccCCccccCCcceeee
Q psy16599          6 RSSASNRIIAAKDHASIQI   24 (73)
Q Consensus         6 KCSaTnRiI~AkDHaSVQI   24 (73)
                      .|.++|.+  ..+.+|+++
T Consensus        52 ~C~a~N~~--G~~~~~~~L   68 (69)
T cd05746          52 ECVARNTI--GYASVSMVL   68 (69)
T ss_pred             EEEEECCC--CcEEEEEEe
Confidence            47777765  234444443


No 44 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=20.90  E-value=64  Score=20.06  Aligned_cols=20  Identities=20%  Similarity=0.149  Sum_probs=16.6

Q ss_pred             ccccccccCCccccCCccee
Q psy16599          3 SLTRSSASNRIIAAKDHASI   22 (73)
Q Consensus         3 iPRKCSaTnRiI~AkDHaSV   22 (73)
                      .|..|+..++.|+.-.++++
T Consensus         8 ~~~~CtSCg~~i~p~e~~v~   27 (61)
T COG2888           8 DPPVCTSCGREIAPGETAVK   27 (61)
T ss_pred             CCceeccCCCEeccCCceeE
Confidence            47899999999988877753


No 45 
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=20.70  E-value=1e+02  Score=21.47  Aligned_cols=21  Identities=29%  Similarity=0.737  Sum_probs=14.4

Q ss_pred             eeeeeeecCCCceeecCeeEEEEehh
Q psy16599         23 QIAIADVDPATGRTTDNLKMYAICGQ   48 (73)
Q Consensus        23 QInva~vd~~~G~~tg~~~tyai~G~   48 (73)
                      |+.|..|+  ||.   .|.||+|-|.
T Consensus        43 ~V~V~Nv~--NG~---Rf~TYvI~g~   63 (126)
T PRK05449         43 KVQIVNVN--NGA---RFETYVIAGE   63 (126)
T ss_pred             EEEEEECC--CCc---EEEEEEEEcC
Confidence            45566666  553   4789999886


No 46 
>PF07976 Phe_hydrox_dim:  Phenol hydroxylase, C-terminal dimerisation domain ;  InterPro: IPR012941 Phenol hydroxylase is a homodimer which hydroxylates phenol to catechol, or similar products. The enzyme is comprised of three domains. The first two domains form the active site. The third domain, this domain, is involved in forming the dimerisation interface. The domain adopts a thioredoxin-like fold [].; PDB: 2DKH_A 2DKI_A 1PN0_A 1FOH_D.
Probab=20.50  E-value=76  Score=21.82  Aligned_cols=27  Identities=15%  Similarity=0.268  Sum_probs=18.6

Q ss_pred             eecCeeEEEEehhhhhcccchHHHHHHH
Q psy16599         36 TTDNLKMYAICGQIRRMGESDDCIGRLA   63 (73)
Q Consensus        36 ~tg~~~tyai~G~iR~~GesD~~lnrL~   63 (73)
                      .+|++..|.++|.++.... -+.|..|+
T Consensus        58 sdGrfri~vFagd~~~~~~-~~~l~~l~   84 (169)
T PF07976_consen   58 SDGRFRILVFAGDISLPEQ-LSRLSALA   84 (169)
T ss_dssp             SSS-EEEEEEEETTTTCHC-CCHHHHHH
T ss_pred             cCCCEEEEEEeCCCccchh-HHHHHHHH
Confidence            4678999999999999443 24455554


No 47 
>PF14858 DUF4486:  Domain of unknown function (DUF4486)
Probab=20.08  E-value=34  Score=28.88  Aligned_cols=29  Identities=21%  Similarity=0.442  Sum_probs=26.8

Q ss_pred             eeecCeeEEEEehhhhhcccchHHHHHHH
Q psy16599         35 RTTDNLKMYAICGQIRRMGESDDCIGRLA   63 (73)
Q Consensus        35 ~~tg~~~tyai~G~iR~~GesD~~lnrL~   63 (73)
                      .|+|...+|.||-.+...|.|++++.-|+
T Consensus       147 i~NGtv~IY~ICr~Lm~~G~s~~vle~L~  175 (542)
T PF14858_consen  147 IYNGTVHIYTICRHLMTAGHSAKVLEYLL  175 (542)
T ss_pred             eeCCeeeHHHHHHHHHHccchHHHHHHHH
Confidence            48999999999999999999999998775


Done!