Diaphorina citri psyllid: psy16599

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MVSLTRSSASNRIIAAKDHASIQIAIADVDPATGRTTDNLKMYAICGQIRRMGESDDCIGRLAKDDGIIAKNY
ccccccccccccccccccccEEEEEEEEEcccccCCcccCEEEEEEHHHHHccccHHHHHHHHHHcccccccc
*VSLTR*SASNRIIAAKDHASIQIAIADVDPATGRTTDNLKMYAICGQIRRMGESDDCIGRLAKDDGIIA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSLTRSSASNRIIAAKDHASIQIAIADVDPATGRTTDNLKMYAICGQIRRMGESDDCIGRLAKDDGIIAKNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S21 May be an associated component of the ribosome rather than a core structural subunit. May act as a translation initiation factor. Has a role in regulation of cell proliferation in the hematopoietic organs and the imaginal disks of larva.very confidentQ29KF5
40S ribosomal protein S21 May be an associated component of the ribosome rather than a core structural subunit. May act as a translation initiation factor. Has a role in regulation of cell proliferation in the hematopoietic organs and the imaginal disks of larva.very confidentO76927
40S ribosomal protein S21 very confidentQ32PB8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042127 [BP]regulation of cell proliferationconfidentGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043022 [MF]ribosome bindingconfidentGO:0043021, GO:0003674, GO:0005488
GO:0015935 [CC]small ribosomal subunitconfidentGO:0005737, GO:0005575, GO:0005622, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0044446, GO:0044444, GO:0043228, GO:0044424, GO:0044391, GO:0043226, GO:0044422
GO:0047485 [MF]protein N-terminus bindingconfidentGO:0003674, GO:0005488, GO:0005515
GO:0048542 [BP]lymph gland developmentconfidentGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0048534, GO:0044699, GO:0002520
GO:0022627 [CC]cytosolic small ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0000461 [BP]endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)probableGO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:0034660, GO:0000479, GO:0000478, GO:0006139, GO:0044260, GO:0042274, GO:0071840, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0016070, GO:0034470, GO:0031125, GO:0009987, GO:0006725, GO:0031123, GO:0000462, GO:0008150, GO:0008152, GO:0043628, GO:0000469, GO:0046483, GO:0090502, GO:0044238, GO:0016072, GO:0090501, GO:0030490, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0006614 [BP]SRP-dependent cotranslational protein targeting to membraneprobableGO:0008104, GO:0006613, GO:0006612, GO:0044699, GO:0070972, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0045047, GO:0033365, GO:0044763, GO:0009987
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0019083 [BP]viral transcriptionprobableGO:0048610, GO:0032774, GO:0019080, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:0006139, GO:0000003, GO:0044260, GO:0071704, GO:0019058, GO:0051704, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0022415, GO:0022414, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044703, GO:0044271, GO:0044237, GO:0043170, GO:0044764, GO:0016032, GO:0019438
GO:0000184 [BP]nuclear-transcribed mRNA catabolic process, nonsense-mediated decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0000447 [BP]endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)probableGO:0008152, GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:0034660, GO:0000479, GO:0000478, GO:0006139, GO:0044260, GO:0042274, GO:0071840, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0016070, GO:0034470, GO:0009987, GO:0006725, GO:0000460, GO:0000462, GO:0008150, GO:0000466, GO:0000469, GO:0046483, GO:0090502, GO:0044238, GO:0016072, GO:0090501, GO:0030490, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0006415 [BP]translational terminationprobableGO:0043933, GO:0044249, GO:0034645, GO:0043241, GO:0044699, GO:0044267, GO:0032984, GO:0044260, GO:0016043, GO:0008150, GO:0071704, GO:0010467, GO:0071840, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0043624, GO:0044238, GO:0071822, GO:0019538, GO:0044237, GO:0043170, GO:0022411, GO:0006412
GO:0006414 [BP]translational elongationprobableGO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006412
GO:0006413 [BP]translational initiationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699
GO:0018996 [BP]molting cycle, collagen and cuticulin-based cuticleprobableGO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5C, chain V
Confidence level:very confident
Coverage over the Query: 1-73
View the alignment between query and template
View the model in PyMOL